BLASTX nr result
ID: Cocculus23_contig00023401
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00023401 (694 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829637.1| hypothetical protein AMTR_s00122p00090920 [A... 57 8e-06 >ref|XP_006829637.1| hypothetical protein AMTR_s00122p00090920 [Amborella trichopoda] gi|548835148|gb|ERM97053.1| hypothetical protein AMTR_s00122p00090920 [Amborella trichopoda] Length = 514 Score = 56.6 bits (135), Expect = 8e-06 Identities = 22/41 (53%), Positives = 32/41 (78%) Frame = +3 Query: 537 KISVVIEAALSSIRCPYPLHAYQIRDLDYSRIHPVVPWIVN 659 K+ IEAAL S+ CP+PLHA+Q++ LDY ++PV+ WIV+ Sbjct: 72 KVGEAIEAALRSMECPFPLHAHQLQGLDYDGVYPVIQWIVS 112