BLASTX nr result
ID: Cocculus23_contig00022972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00022972 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73925.1| hypothetical protein VITISV_005807 [Vitis vinifera] 62 8e-08 emb|CBI27735.3| unnamed protein product [Vitis vinifera] 60 4e-07 >emb|CAN73925.1| hypothetical protein VITISV_005807 [Vitis vinifera] Length = 876 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/80 (42%), Positives = 47/80 (58%) Frame = +3 Query: 3 DLGVNTGDSSSPSSTDNAKVDGHQFENKENGKIFGRASPRFGKDSPGKNQSGYTLKDNDH 182 D +N G S SP S DN +VD HQF+ ++NGK ASP D KN + ++D+ + Sbjct: 700 DSEINKGVSPSPKSVDNIQVDDHQFDVRDNGKTSPLASPSIVSDGTIKNLNASVVEDH-N 758 Query: 183 QNIELRLNSEESEGLASPSG 242 Q + + N + SEGL SPSG Sbjct: 759 QEMGFQTNLDGSEGLPSPSG 778 >emb|CBI27735.3| unnamed protein product [Vitis vinifera] Length = 1778 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/80 (41%), Positives = 46/80 (57%) Frame = +3 Query: 3 DLGVNTGDSSSPSSTDNAKVDGHQFENKENGKIFGRASPRFGKDSPGKNQSGYTLKDNDH 182 D + G S SP S DN +VD HQF+ ++NGK ASP D KN + ++D+ + Sbjct: 1427 DSEITKGVSPSPKSVDNIQVDDHQFDVRDNGKTSPLASPSIVSDGTIKNLNASVVEDH-N 1485 Query: 183 QNIELRLNSEESEGLASPSG 242 Q + + N + SEGL SPSG Sbjct: 1486 QEMGFQTNLDGSEGLPSPSG 1505