BLASTX nr result
ID: Cocculus23_contig00022825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00022825 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214946.1| hypothetical protein PRUPE_ppa002968mg [Prun... 56 5e-06 >ref|XP_007214946.1| hypothetical protein PRUPE_ppa002968mg [Prunus persica] gi|462411096|gb|EMJ16145.1| hypothetical protein PRUPE_ppa002968mg [Prunus persica] Length = 616 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/48 (50%), Positives = 32/48 (66%) Frame = +2 Query: 260 NLISGVLIGLTVSLGLICVHFVWSSGPALPRVDFDGGGEDGNDPVLGG 403 NL+ VLIGL V LGL+C+++ WS GP R D + DG+DP+ GG Sbjct: 14 NLLKSVLIGLVVCLGLLCLYYGWSFGPGSRRSDEEASRSDGSDPIFGG 61