BLASTX nr result
ID: Cocculus23_contig00022745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00022745 (722 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] 39 4e-06 >emb|CAN66445.1| hypothetical protein VITISV_003574 [Vitis vinifera] Length = 1290 Score = 39.3 bits (90), Expect(3) = 4e-06 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 720 HRKINTMDMVQRRNPQCALSPHCCVSCM 637 H+K+NT DM+Q R P ALSP C+ CM Sbjct: 629 HKKVNTNDMLQVRRPYKALSPDICILCM 656 Score = 36.2 bits (82), Expect(3) = 4e-06 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 655 LLCVMYGHGESVGRTFIHCSFAKEVWHGCQVFTNVKIDPPQSHN*IFIIQL-GISSSRR 482 +LC+ HGES F+HCS +WH + + PP+S + I+ G SS+R Sbjct: 653 ILCMK--HGESADHIFLHCSLTIRLWHRLFQLAKMDLVPPRSIFDMMSIKFNGFGSSKR 709 Score = 20.8 bits (42), Expect(3) = 4e-06 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 488 KEGLRLEIVPFMPTICSIWLERNMIIFDSLI 396 K GL L + I +W ERN IF+ + Sbjct: 708 KRGLVLWQAASIALIRVVWWERNARIFEDKV 738