BLASTX nr result
ID: Cocculus23_contig00022311
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00022311 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382855.1| serine carboxypeptidase S10 family protein [... 59 7e-07 ref|XP_002526021.1| Vitellogenic carboxypeptidase, putative [Ric... 56 5e-06 >ref|XP_006382855.1| serine carboxypeptidase S10 family protein [Populus trichocarpa] gi|550338225|gb|ERP60652.1| serine carboxypeptidase S10 family protein [Populus trichocarpa] Length = 461 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/45 (60%), Positives = 38/45 (84%), Gaps = 3/45 (6%) Frame = -2 Query: 128 QNKAVRLTRE---GKYVPAIGHYILQQNSRLPLSRQVNLKGIAIG 3 + +++ +T E GKYVPAIGHYIL++N +LP+S+QVNLKG+AIG Sbjct: 175 KTRSIYITGESYAGKYVPAIGHYILKKNMKLPVSKQVNLKGVAIG 219 >ref|XP_002526021.1| Vitellogenic carboxypeptidase, putative [Ricinus communis] gi|223534668|gb|EEF36361.1| Vitellogenic carboxypeptidase, putative [Ricinus communis] Length = 441 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/47 (59%), Positives = 38/47 (80%), Gaps = 3/47 (6%) Frame = -2 Query: 134 EMQNKAVRLTRE---GKYVPAIGHYILQQNSRLPLSRQVNLKGIAIG 3 E +N+ + LT E GKYVPAIG++IL++N RL +S+QVNLKG+AIG Sbjct: 158 EFKNRPLYLTGESYAGKYVPAIGYHILKKNMRLQVSKQVNLKGVAIG 204