BLASTX nr result
ID: Cocculus23_contig00019960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019960 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007152034.1| hypothetical protein PHAVU_004G096100g [Phas... 58 2e-06 >ref|XP_007152034.1| hypothetical protein PHAVU_004G096100g [Phaseolus vulgaris] gi|561025343|gb|ESW24028.1| hypothetical protein PHAVU_004G096100g [Phaseolus vulgaris] Length = 375 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/56 (51%), Positives = 33/56 (58%) Frame = -2 Query: 208 YIFSFLPTKQAVRASILSKRWKKFWVSIPYVSFHLNETRADYGVSDERNYLDRFLY 41 YI SFLPTKQ V S+LSKRWK W S+P + FHL DY NY R L+ Sbjct: 15 YILSFLPTKQVVTTSVLSKRWKLLWRSVPSLDFHLRAPDMDY-----MNYESRKLF 65