BLASTX nr result
ID: Cocculus23_contig00019773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019773 (588 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007028839.1| Exostosin family protein isoform 1 [Theobrom... 59 1e-06 >ref|XP_007028839.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|590636390|ref|XP_007028840.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|508717444|gb|EOY09341.1| Exostosin family protein isoform 1 [Theobroma cacao] gi|508717445|gb|EOY09342.1| Exostosin family protein isoform 1 [Theobroma cacao] Length = 794 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -1 Query: 126 MMFAVKTWKCSPSLIAIVASLAILVSIVHLVFFPLVPPFGYF 1 MMF+V+ WKCS SL+A VAS+ + VS+VHL FP+VP F YF Sbjct: 1 MMFSVQKWKCSWSLVATVASVIVPVSVVHLFLFPVVPSFDYF 42