BLASTX nr result
ID: Cocculus23_contig00019740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019740 (1103 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40215.3| unnamed protein product [Vitis vinifera] 93 2e-16 ref|XP_002267472.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-16 ref|XP_007216279.1| hypothetical protein PRUPE_ppa017414mg, part... 93 2e-16 gb|EYU28659.1| hypothetical protein MIMGU_mgv1a022202mg, partial... 92 3e-16 gb|ADE76509.1| unknown [Picea sitchensis] 92 4e-16 ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containi... 91 7e-16 emb|CBI32403.3| unnamed protein product [Vitis vinifera] 91 7e-16 emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] 91 7e-16 ref|XP_007203303.1| hypothetical protein PRUPE_ppa025850mg, part... 91 1e-15 ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-15 ref|XP_004242990.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-15 ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containi... 90 2e-15 ref|NP_567948.1| pentatricopeptide repeat-containing protein [Ar... 89 3e-15 ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] g... 89 3e-15 ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citr... 89 3e-15 dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] 89 3e-15 ref|XP_003596787.1| Pentatricopeptide repeat-containing protein ... 89 3e-15 ref|XP_001780298.1| predicted protein [Physcomitrella patens] gi... 89 3e-15 ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfam... 89 4e-15 ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containi... 88 6e-15 >emb|CBI40215.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 93.2 bits (230), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLRICGDCHTF KF+SKVT R I+IRDGNRFHHF+DG CSCGDYW Sbjct: 609 NLRICGDCHTFMKFMSKVTLRKIIIRDGNRFHHFRDGSCSCGDYW 653 >ref|XP_002267472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 1058 Score = 93.2 bits (230), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLRICGDCHTF KF+SKVT R I+IRDGNRFHHF+DG CSCGDYW Sbjct: 1014 NLRICGDCHTFMKFMSKVTLRKIIIRDGNRFHHFRDGSCSCGDYW 1058 >ref|XP_007216279.1| hypothetical protein PRUPE_ppa017414mg, partial [Prunus persica] gi|462412429|gb|EMJ17478.1| hypothetical protein PRUPE_ppa017414mg, partial [Prunus persica] Length = 576 Score = 92.8 bits (229), Expect = 2e-16 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR CGDCH+F KFVS V QR I++RDGNRFHHFQDGLCSCGDYW Sbjct: 532 NLRTCGDCHSFMKFVSSVAQRKIILRDGNRFHHFQDGLCSCGDYW 576 >gb|EYU28659.1| hypothetical protein MIMGU_mgv1a022202mg, partial [Mimulus guttatus] Length = 682 Score = 92.4 bits (228), Expect = 3e-16 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKFVSKVT+R IV+RD NRFHHF+DG+CSCGDYW Sbjct: 638 NLRVCGDCHNVTKFVSKVTEREIVVRDSNRFHHFRDGICSCGDYW 682 >gb|ADE76509.1| unknown [Picea sitchensis] Length = 246 Score = 92.0 bits (227), Expect = 4e-16 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCHT TKF+SK+ +R I+IRD NRFHHF+DGLCSCGDYW Sbjct: 202 NLRVCGDCHTATKFISKIVEREIIIRDANRFHHFKDGLCSCGDYW 246 >ref|XP_003631669.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Vitis vinifera] Length = 891 Score = 91.3 bits (225), Expect = 7e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+S++TQR IV+RD NRFHHF+DG+CSCGDYW Sbjct: 847 NLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICSCGDYW 891 >emb|CBI32403.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 91.3 bits (225), Expect = 7e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+S++TQR IV+RD NRFHHF+DG+CSCGDYW Sbjct: 614 NLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICSCGDYW 658 >emb|CAN64990.1| hypothetical protein VITISV_001772 [Vitis vinifera] Length = 891 Score = 91.3 bits (225), Expect = 7e-16 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+S++TQR IV+RD NRFHHF+DG+CSCGDYW Sbjct: 847 NLRVCGDCHNATKFISRITQREIVVRDSNRFHHFKDGICSCGDYW 891 >ref|XP_007203303.1| hypothetical protein PRUPE_ppa025850mg, partial [Prunus persica] gi|462398834|gb|EMJ04502.1| hypothetical protein PRUPE_ppa025850mg, partial [Prunus persica] Length = 554 Score = 90.5 bits (223), Expect = 1e-15 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCHTFTKFVS VTQR I++RD NRFHHF++G CSCGDYW Sbjct: 510 NLRVCGDCHTFTKFVSAVTQRVIIVRDVNRFHHFREGTCSCGDYW 554 >ref|XP_004137278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] gi|449476583|ref|XP_004154777.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Cucumis sativus] Length = 816 Score = 90.5 bits (223), Expect = 1e-15 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+SK+T+R I++RD NRFHHF+DG+CSCGDYW Sbjct: 772 NLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGVCSCGDYW 816 >ref|XP_004242990.1| PREDICTED: pentatricopeptide repeat-containing protein At4g30700-like [Solanum lycopersicum] Length = 791 Score = 90.1 bits (222), Expect = 1e-15 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+C DCH FTKFVSKVT RN+V+RD NRFHHF+DG CSCGDYW Sbjct: 747 NLRVCVDCHNFTKFVSKVTDRNVVVRDTNRFHHFKDGECSCGDYW 791 >ref|XP_003553033.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X1 [Glycine max] gi|571544149|ref|XP_006602168.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X2 [Glycine max] gi|571544153|ref|XP_006602169.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X3 [Glycine max] gi|571544157|ref|XP_006602170.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X4 [Glycine max] gi|571544163|ref|XP_006602171.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like isoform X5 [Glycine max] Length = 824 Score = 89.7 bits (221), Expect = 2e-15 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TK++SK+T+R I++RD NRFHHF+DG+CSCGDYW Sbjct: 780 NLRVCGDCHNATKYISKITEREIIVRDSNRFHHFKDGICSCGDYW 824 >ref|NP_567948.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635622|sp|O81767.2|PP348_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g33990; AltName: Full=Protein EMBRYO DEFECTIVE 2758 gi|332660906|gb|AEE86306.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 823 Score = 89.4 bits (220), Expect = 3e-15 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH+ TKF+SK+T+R I++RD NRFHHF++G+CSCGDYW Sbjct: 779 NLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 823 >ref|XP_002867139.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] gi|297312975|gb|EFH43398.1| EMB2758 [Arabidopsis lyrata subsp. lyrata] Length = 824 Score = 89.4 bits (220), Expect = 3e-15 Identities = 32/45 (71%), Positives = 42/45 (93%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH+ TKF+SK+T+R I++RD NRFHHF++G+CSCGDYW Sbjct: 780 NLRVCGDCHSVTKFISKITEREIIVRDSNRFHHFKNGVCSCGDYW 824 >ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] gi|557549487|gb|ESR60116.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] Length = 714 Score = 89.0 bits (219), Expect = 3e-15 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCHT TKF+SKVT R IV+RD +RFHHF+DG CSCGDYW Sbjct: 670 NLRVCGDCHTATKFISKVTGREIVVRDAHRFHHFKDGTCSCGDYW 714 >dbj|BAD67155.1| PpPPR_98 [Physcomitrella patens] Length = 986 Score = 89.0 bits (219), Expect = 3e-15 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCHT TKF+SK+T+R I+ RD NRFHHF+DG+CSCGD+W Sbjct: 942 NLRVCGDCHTATKFISKITKRQIIARDSNRFHHFKDGVCSCGDFW 986 >ref|XP_003596787.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355485835|gb|AES67038.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 867 Score = 89.0 bits (219), Expect = 3e-15 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH FTK VS V QR IV+RD NRFHHF+DGLCSCGDYW Sbjct: 823 NLRVCGDCHNFTKLVSLVEQRYIVVRDSNRFHHFKDGLCSCGDYW 867 >ref|XP_001780298.1| predicted protein [Physcomitrella patens] gi|162668246|gb|EDQ54857.1| predicted protein [Physcomitrella patens] Length = 986 Score = 89.0 bits (219), Expect = 3e-15 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCHT TKF+SK+T+R I+ RD NRFHHF+DG+CSCGD+W Sbjct: 942 NLRVCGDCHTATKFISKITKRQIIARDSNRFHHFKDGVCSCGDFW 986 >ref|XP_007042438.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508706373|gb|EOX98269.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 820 Score = 88.6 bits (218), Expect = 4e-15 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+S++T R I++RD NRFHHF+DG+CSCGDYW Sbjct: 776 NLRVCGDCHNATKFISQITDREIIVRDSNRFHHFKDGICSCGDYW 820 >ref|XP_006651472.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Oryza brachyantha] Length = 749 Score = 88.2 bits (217), Expect = 6e-15 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +3 Query: 3 NLRICGDCHTFTKFVSKVTQRNIVIRDGNRFHHFQDGLCSCGDYW 137 NLR+CGDCH TKF+SK+T+R I++RD NRFHHF+DG CSCGD+W Sbjct: 705 NLRVCGDCHNATKFISKITEREIIVRDSNRFHHFKDGYCSCGDFW 749