BLASTX nr result
ID: Cocculus23_contig00019668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019668 (382 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001141555.1| alternative oxidase [Zea mays] gi|194705058|... 79 9e-13 ref|XP_006413676.1| hypothetical protein EUTSA_v10025624mg [Eutr... 75 1e-11 ref|XP_006284019.1| hypothetical protein CARUB_v10005140mg [Caps... 75 1e-11 emb|CAA06190.1| Immutans protein [Arabidopsis thaliana] 75 1e-11 ref|NP_567658.1| alternative oxidase protein IMMUTANS [Arabidops... 75 1e-11 ref|XP_002867779.1| hypothetical protein ARALYDRAFT_492640 [Arab... 75 1e-11 emb|CAA16776.1| putative protein [Arabidopsis thaliana] gi|72690... 75 1e-11 ref|NP_001173715.1| Os03g0847500 [Oryza sativa Japonica Group] g... 74 2e-11 gb|EXC58073.1| Alternative oxidase 4 [Morus notabilis] 74 3e-11 ref|XP_006597600.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 74 3e-11 ref|XP_006467359.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 74 3e-11 ref|XP_007147674.1| hypothetical protein PHAVU_006G144800g [Phas... 74 3e-11 ref|XP_006449826.1| hypothetical protein CICLE_v10015546mg [Citr... 74 3e-11 gb|EPS61569.1| alternative oxidase [Genlisea aurea] 74 3e-11 ref|XP_007026216.1| Alternative oxidase family protein isoform 2... 74 3e-11 ref|XP_007026215.1| Alternative oxidase family protein isoform 1... 74 3e-11 ref|XP_004486200.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 74 3e-11 ref|XP_007211495.1| hypothetical protein PRUPE_ppa007820mg [Prun... 74 3e-11 ref|XP_004145426.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 74 3e-11 gb|ACA53387.2| plastid terminal oxidase [Daucus carota] 74 3e-11 >ref|NP_001141555.1| alternative oxidase [Zea mays] gi|194705058|gb|ACF86613.1| unknown [Zea mays] gi|414584891|tpg|DAA35462.1| TPA: alternative oxidase [Zea mays] Length = 211 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/65 (55%), Positives = 43/65 (66%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIMEVCMFALASGQGLYCFKCVYLIATVMANEL 182 YETFGWWRRADYLKVHFA+S NE HHLLIMEV +F + S F+C Y+ N + Sbjct: 146 YETFGWWRRADYLKVHFAQSLNEFHHLLIMEVRIFPVKSMCARSSFQCYYVKVISRLNFI 205 Query: 183 EATWY 197 W+ Sbjct: 206 PFCWF 210 >ref|XP_006413676.1| hypothetical protein EUTSA_v10025624mg [Eutrema salsugineum] gi|557114846|gb|ESQ55129.1| hypothetical protein EUTSA_v10025624mg [Eutrema salsugineum] Length = 346 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 149 YETFGWWRRADYLKVHFAESWNEMHHLLIME 179 >ref|XP_006284019.1| hypothetical protein CARUB_v10005140mg [Capsella rubella] gi|482552724|gb|EOA16917.1| hypothetical protein CARUB_v10005140mg [Capsella rubella] Length = 353 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 156 YETFGWWRRADYLKVHFAESWNEMHHLLIME 186 >emb|CAA06190.1| Immutans protein [Arabidopsis thaliana] Length = 351 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 153 YETFGWWRRADYLKVHFAESWNEMHHLLIME 183 >ref|NP_567658.1| alternative oxidase protein IMMUTANS [Arabidopsis thaliana] gi|85681033|sp|Q56X52.2|AOX4_ARATH RecName: Full=Ubiquinol oxidase 4, chloroplastic/chromoplastic; AltName: Full=Alternative oxidase 4; AltName: Full=Plastid terminal oxidase; AltName: Full=Protein IMMUTANS; Flags: Precursor gi|11692822|gb|AAG40014.1|AF324663_1 AT4g22260 [Arabidopsis thaliana] gi|11908102|gb|AAG41480.1|AF326898_1 unknown protein [Arabidopsis thaliana] gi|12642914|gb|AAK00399.1|AF339717_1 unknown protein [Arabidopsis thaliana] gi|4138855|gb|AAD03599.1| IMMUTANS [Arabidopsis thaliana] gi|15010796|gb|AAK74057.1| AT4g22260/T10I14_90 [Arabidopsis thaliana] gi|23308315|gb|AAN18127.1| At4g22260/T10I14_90 [Arabidopsis thaliana] gi|332659183|gb|AEE84583.1| alternative oxidase protein IMMUTANS [Arabidopsis thaliana] Length = 351 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 153 YETFGWWRRADYLKVHFAESWNEMHHLLIME 183 >ref|XP_002867779.1| hypothetical protein ARALYDRAFT_492640 [Arabidopsis lyrata subsp. lyrata] gi|297313615|gb|EFH44038.1| hypothetical protein ARALYDRAFT_492640 [Arabidopsis lyrata subsp. lyrata] Length = 351 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 153 YETFGWWRRADYLKVHFAESWNEMHHLLIME 183 >emb|CAA16776.1| putative protein [Arabidopsis thaliana] gi|7269072|emb|CAB79181.1| putative protein [Arabidopsis thaliana] Length = 335 Score = 75.1 bits (183), Expect = 1e-11 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YETFGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 153 YETFGWWRRADYLKVHFAESWNEMHHLLIME 183 >ref|NP_001173715.1| Os03g0847500 [Oryza sativa Japonica Group] gi|255675049|dbj|BAH92443.1| Os03g0847500, partial [Oryza sativa Japonica Group] Length = 44 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIMEV 98 YETFGWWRRADY+KVHFAESWNE HHLLIMEV Sbjct: 11 YETFGWWRRADYIKVHFAESWNEFHHLLIMEV 42 >gb|EXC58073.1| Alternative oxidase 4 [Morus notabilis] Length = 509 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 275 YESFGWWRRADYLKVHFAESWNEMHHLLIME 305 >ref|XP_006597600.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic isoform X2 [Glycine max] Length = 366 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 167 YESFGWWRRADYLKVHFAESWNEMHHLLIME 197 >ref|XP_006467359.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Citrus sinensis] Length = 349 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 143 YESFGWWRRADYLKVHFAESWNEMHHLLIME 173 >ref|XP_007147674.1| hypothetical protein PHAVU_006G144800g [Phaseolus vulgaris] gi|561020897|gb|ESW19668.1| hypothetical protein PHAVU_006G144800g [Phaseolus vulgaris] Length = 330 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 131 YESFGWWRRADYLKVHFAESWNEMHHLLIME 161 >ref|XP_006449826.1| hypothetical protein CICLE_v10015546mg [Citrus clementina] gi|557552437|gb|ESR63066.1| hypothetical protein CICLE_v10015546mg [Citrus clementina] Length = 389 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 183 YESFGWWRRADYLKVHFAESWNEMHHLLIME 213 >gb|EPS61569.1| alternative oxidase [Genlisea aurea] Length = 377 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 170 YESFGWWRRADYLKVHFAESWNEMHHLLIME 200 >ref|XP_007026216.1| Alternative oxidase family protein isoform 2 [Theobroma cacao] gi|508781582|gb|EOY28838.1| Alternative oxidase family protein isoform 2 [Theobroma cacao] Length = 357 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 153 YESFGWWRRADYLKVHFAESWNEMHHLLIME 183 >ref|XP_007026215.1| Alternative oxidase family protein isoform 1 [Theobroma cacao] gi|508781581|gb|EOY28837.1| Alternative oxidase family protein isoform 1 [Theobroma cacao] Length = 430 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 225 YESFGWWRRADYLKVHFAESWNEMHHLLIME 255 >ref|XP_004486200.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Cicer arietinum] Length = 346 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 146 YESFGWWRRADYLKVHFAESWNEMHHLLIME 176 >ref|XP_007211495.1| hypothetical protein PRUPE_ppa007820mg [Prunus persica] gi|462407360|gb|EMJ12694.1| hypothetical protein PRUPE_ppa007820mg [Prunus persica] Length = 354 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 156 YESFGWWRRADYLKVHFAESWNEMHHLLIME 186 >ref|XP_004145426.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Cucumis sativus] gi|449525172|ref|XP_004169592.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Cucumis sativus] Length = 355 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 150 YESFGWWRRADYLKVHFAESWNEMHHLLIME 180 >gb|ACA53387.2| plastid terminal oxidase [Daucus carota] Length = 365 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 3 YETFGWWRRADYLKVHFAESWNEMHHLLIME 95 YE+FGWWRRADYLKVHFAESWNEMHHLLIME Sbjct: 163 YESFGWWRRADYLKVHFAESWNEMHHLLIME 193