BLASTX nr result
ID: Cocculus23_contig00019650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019650 (218 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006427423.1| hypothetical protein CICLE_v10025140mg [Citr... 57 2e-06 >ref|XP_006427423.1| hypothetical protein CICLE_v10025140mg [Citrus clementina] gi|557529413|gb|ESR40663.1| hypothetical protein CICLE_v10025140mg [Citrus clementina] Length = 635 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/60 (50%), Positives = 34/60 (56%) Frame = +3 Query: 3 QLCQLNNVGIMDLSHNNLYGTIPPCFRNISFGKTSDSKNLFETQMQYVFNFAQEGSMGTY 182 QLCQL +GIMDLSHN L G IP C NISFG+ + FE Y F + S TY Sbjct: 346 QLCQLRKLGIMDLSHNRLNGPIPSCLGNISFGREAIDDGSFE----YEFAMSNRDSASTY 401