BLASTX nr result
ID: Cocculus23_contig00019215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019215 (542 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006827031.1| hypothetical protein AMTR_s00010p00223360 [A... 60 3e-07 ref|XP_002285815.1| PREDICTED: membrane-anchored ubiquitin-fold ... 59 8e-07 ref|XP_003564063.1| PREDICTED: membrane-anchored ubiquitin-fold ... 57 4e-06 gb|AFW73461.1| hypothetical protein ZEAMMB73_831091 [Zea mays] 56 6e-06 gb|AFW73460.1| hypothetical protein ZEAMMB73_831091 [Zea mays] 56 6e-06 gb|AFW64466.1| hypothetical protein ZEAMMB73_605636 [Zea mays] 56 6e-06 gb|ACG38427.1| NTGP5 [Zea mays] gi|224032649|gb|ACN35400.1| unkn... 56 6e-06 ref|NP_001132156.1| uncharacterized protein LOC100193576 [Zea ma... 56 6e-06 >ref|XP_006827031.1| hypothetical protein AMTR_s00010p00223360 [Amborella trichopoda] gi|548831460|gb|ERM94268.1| hypothetical protein AMTR_s00010p00223360 [Amborella trichopoda] Length = 129 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/32 (75%), Positives = 31/32 (96%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQG 98 L+DGTDIGPNKY P+T+IGSLKE+I+++WPQG Sbjct: 13 LYDGTDIGPNKYPPATTIGSLKEIIVARWPQG 44 >ref|XP_002285815.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3 [Vitis vinifera] gi|302141907|emb|CBI19110.3| unnamed protein product [Vitis vinifera] Length = 118 Score = 58.9 bits (141), Expect = 8e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 L DGTDIGPNKYNP+TS+GSLKE IL+QWP+ Sbjct: 13 LADGTDIGPNKYNPTTSVGSLKEKILAQWPK 43 >ref|XP_003564063.1| PREDICTED: membrane-anchored ubiquitin-fold protein 3-like [Brachypodium distachyon] Length = 118 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP+KY+PSTS+ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPSKYDPSTSVTSLKEFILARWPQ 44 >gb|AFW73461.1| hypothetical protein ZEAMMB73_831091 [Zea mays] Length = 118 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP KY+PST++ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPTKYDPSTTVSSLKEFILARWPQ 44 >gb|AFW73460.1| hypothetical protein ZEAMMB73_831091 [Zea mays] Length = 119 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP KY+PST++ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPTKYDPSTTVSSLKEFILARWPQ 44 >gb|AFW64466.1| hypothetical protein ZEAMMB73_605636 [Zea mays] Length = 119 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP KY+PST++ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPTKYDPSTTVSSLKEFILARWPQ 44 >gb|ACG38427.1| NTGP5 [Zea mays] gi|224032649|gb|ACN35400.1| unknown [Zea mays] gi|413924533|gb|AFW64465.1| NTGP5 [Zea mays] Length = 118 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP KY+PST++ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPTKYDPSTTVSSLKEFILARWPQ 44 >ref|NP_001132156.1| uncharacterized protein LOC100193576 [Zea mays] gi|194693594|gb|ACF80881.1| unknown [Zea mays] gi|413924535|gb|AFW64467.1| hypothetical protein ZEAMMB73_605636 [Zea mays] Length = 118 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 3 LFDGTDIGPNKYNPSTSIGSLKEVILSQWPQ 95 LFDGTDIGP KY+PST++ SLKE IL++WPQ Sbjct: 14 LFDGTDIGPTKYDPSTTVSSLKEFILARWPQ 44