BLASTX nr result
ID: Cocculus23_contig00019003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00019003 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD33115.1| SAM (and some other nucleotide) binding motif; Me... 60 4e-07 ref|XP_003605160.1| Pentatricopeptide repeat-containing protein ... 60 4e-07 ref|NP_187952.1| S-adenosyl-L-methionine-dependent methyltransfe... 56 5e-06 ref|XP_002882825.1| hypothetical protein ARALYDRAFT_318122 [Arab... 56 6e-06 >gb|ABD33115.1| SAM (and some other nucleotide) binding motif; Methyltransferase small; Tetratricopeptide-like helical [Medicago truncatula] Length = 971 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 6/83 (7%) Frame = +1 Query: 28 AVPSRQGSVNVGASGMEPYNIELDSGNSCLSSIR------TREGSKSKNSSVPFKMPPKS 189 + P + VG S +++D +S L I+ T + + S+N FK K+ Sbjct: 665 SAPKLSMDLKVGRSWHYERRLDIDQSDSALELIKSSYLHITIKLNNSENGKASFKDLSKT 724 Query: 190 AQIRLVSGHPEVYEPCDDSFALV 258 AQIRLVS H EVYEPCDDSFALV Sbjct: 725 AQIRLVSSHNEVYEPCDDSFALV 747 >ref|XP_003605160.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355506215|gb|AES87357.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1026 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/83 (42%), Positives = 46/83 (55%), Gaps = 6/83 (7%) Frame = +1 Query: 28 AVPSRQGSVNVGASGMEPYNIELDSGNSCLSSIR------TREGSKSKNSSVPFKMPPKS 189 + P + VG S +++D +S L I+ T + + S+N FK K+ Sbjct: 720 SAPKLSMDLKVGRSWHYERRLDIDQSDSALELIKSSYLHITIKLNNSENGKASFKDLSKT 779 Query: 190 AQIRLVSGHPEVYEPCDDSFALV 258 AQIRLVS H EVYEPCDDSFALV Sbjct: 780 AQIRLVSSHNEVYEPCDDSFALV 802 >ref|NP_187952.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] gi|18377858|gb|AAL67115.1| AT3g13440/MRP15_7 [Arabidopsis thaliana] gi|20453313|gb|AAM19895.1| AT3g13440/MRP15_7 [Arabidopsis thaliana] gi|332641833|gb|AEE75354.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein [Arabidopsis thaliana] Length = 278 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 154 NSSVPFKMPPKSAQIRLVSGHPEVYEPCDDSFALV 258 +S V +KMPP+ A IRLVS H EVYEPCDDSFALV Sbjct: 26 HSQVIYKMPPRIAAIRLVSSHREVYEPCDDSFALV 60 >ref|XP_002882825.1| hypothetical protein ARALYDRAFT_318122 [Arabidopsis lyrata subsp. lyrata] gi|297328665|gb|EFH59084.1| hypothetical protein ARALYDRAFT_318122 [Arabidopsis lyrata subsp. lyrata] Length = 278 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +1 Query: 154 NSSVPFKMPPKSAQIRLVSGHPEVYEPCDDSFALV 258 +S V +KMPP+ A IRLVS H EVYEPCDDSFALV Sbjct: 26 HSPVIYKMPPRIAAIRLVSSHREVYEPCDDSFALV 60