BLASTX nr result
ID: Cocculus23_contig00018702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00018702 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 emb|CBI31119.3| unnamed protein product [Vitis vinifera] 61 2e-07 >ref|XP_002265420.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 537 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -1 Query: 261 VKKVPGCSLIEVDGVVYEFVAGDISHSCMDEIXXXXXXXXXXXKTFGWSDDD 106 VKKVPGCSLIEVDG V+EFVAGD+SH MDEI K+ WS+DD Sbjct: 479 VKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKSL-WSEDD 529 >emb|CBI31119.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/52 (61%), Positives = 36/52 (69%) Frame = -1 Query: 261 VKKVPGCSLIEVDGVVYEFVAGDISHSCMDEIXXXXXXXXXXXKTFGWSDDD 106 VKKVPGCSLIEVDG V+EFVAGD+SH MDEI K+ WS+DD Sbjct: 454 VKKVPGCSLIEVDGAVFEFVAGDMSHVFMDEIVLLLLGIDKHLKSL-WSEDD 504