BLASTX nr result
ID: Cocculus23_contig00017462
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00017462 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME40759.1| hypothetical protein DOTSEDRAFT_74342 [Dothistrom... 65 1e-08 >gb|EME40759.1| hypothetical protein DOTSEDRAFT_74342 [Dothistroma septosporum NZE10] Length = 641 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/59 (55%), Positives = 44/59 (74%), Gaps = 1/59 (1%) Frame = -3 Query: 178 GVVTITDSLLNELIIGDIKDLEPDTVQKYVQAKLVWRMVTSDEVDICG-NATSNGLALE 5 GVV +TD+LLN LI G IKD++P TV++YV AKLVWR+VT+ DI G A +GL ++ Sbjct: 509 GVVPLTDALLNTLIAGGIKDMKPATVRQYVHAKLVWRLVTASGKDIGGTEARDSGLTIK 567