BLASTX nr result
ID: Cocculus23_contig00017267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00017267 (507 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39059.1| hypothetical protein DOTSEDRAFT_29239 [Dothistrom... 59 7e-07 gb|EMF14833.1| hypothetical protein SEPMUDRAFT_148416 [Sphaeruli... 57 2e-06 ref|XP_003070296.1| hypothetical protein CPC735_034870 [Coccidio... 56 6e-06 ref|XP_001243257.1| predicted protein [Coccidioides immitis RS] ... 56 6e-06 >gb|EME39059.1| hypothetical protein DOTSEDRAFT_29239 [Dothistroma septosporum NZE10] Length = 87 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/59 (52%), Positives = 44/59 (74%), Gaps = 5/59 (8%) Frame = -1 Query: 369 AKDILATFKDGADLNDEGQP-----KQKDSSLKIHIELDLEVELHLSARVQGDITIGLL 208 AK+ +A + G D G P K+++SSLKIHI+LDL+V++HL+AR++GDITIGLL Sbjct: 29 AKNDVAGGRKGETGTDGGPPVATPKKEEESSLKIHIKLDLDVDIHLTARIKGDITIGLL 87 >gb|EMF14833.1| hypothetical protein SEPMUDRAFT_148416 [Sphaerulina musiva SO2202] Length = 98 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -1 Query: 333 DLNDEGQPKQKDSSLKIHIELDLEVELHLSARVQGDITIGLL 208 D N +G+ +++SSLKI I+LDL+VE+HL+ARV+GDITIGLL Sbjct: 57 DGNGKGKKDEENSSLKIRIQLDLDVEIHLTARVKGDITIGLL 98 >ref|XP_003070296.1| hypothetical protein CPC735_034870 [Coccidioides posadasii C735 delta SOWgp] gi|240109982|gb|EER28151.1| hypothetical protein CPC735_034870 [Coccidioides posadasii C735 delta SOWgp] gi|320041394|gb|EFW23327.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] Length = 123 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -1 Query: 330 LNDEGQPK-QKDSSLKIHIELDLEVELHLSARVQGDITIGLL 208 + D QPK Q+D+SLK+ IELDLEVE+ L ARVQGD+TIGL+ Sbjct: 82 IKDRPQPKDQRDNSLKVKIELDLEVEVDLYARVQGDVTIGLM 123 >ref|XP_001243257.1| predicted protein [Coccidioides immitis RS] gi|392866145|gb|EAS28757.2| hypothetical protein CIMG_07153 [Coccidioides immitis RS] Length = 123 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/42 (66%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -1 Query: 330 LNDEGQPK-QKDSSLKIHIELDLEVELHLSARVQGDITIGLL 208 + D QPK Q+D+SLK+ IELDLEVE+ L ARVQGD+TIGL+ Sbjct: 82 IKDRPQPKDQRDNSLKVKIELDLEVEVDLYARVQGDVTIGLM 123