BLASTX nr result
ID: Cocculus23_contig00017026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00017026 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200332.1| hypothetical protein PRUPE_ppa010395mg [Prun... 66 6e-09 ref|XP_007199960.1| hypothetical protein PRUPE_ppa026313mg, part... 65 1e-08 ref|XP_003631634.1| PREDICTED: nogo-B receptor-like isoform 1 [V... 65 1e-08 emb|CAN70934.1| hypothetical protein VITISV_032483 [Vitis vinifera] 65 1e-08 gb|EXB63592.1| hypothetical protein L484_026931 [Morus notabilis] 63 5e-08 ref|XP_003610809.1| Nogo-B receptor [Medicago truncatula] gi|355... 63 5e-08 ref|XP_002519078.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|XP_004299106.1| PREDICTED: nogo-B receptor-like [Fragaria ve... 62 6e-08 ref|XP_002305421.2| hypothetical protein POPTR_0004s16020g [Popu... 62 1e-07 ref|XP_006384501.1| hypothetical protein POPTR_0004s16020g [Popu... 62 1e-07 ref|XP_003610814.1| Nogo-B receptor [Medicago truncatula] gi|355... 61 1e-07 ref|XP_006423225.1| hypothetical protein CICLE_v10028976mg [Citr... 61 2e-07 ref|XP_006423223.1| hypothetical protein CICLE_v10028976mg [Citr... 61 2e-07 ref|XP_006423222.1| hypothetical protein CICLE_v10028976mg [Citr... 61 2e-07 ref|XP_004511413.1| PREDICTED: nogo-B receptor-like [Cicer ariet... 60 3e-07 ref|XP_006572869.1| PREDICTED: uncharacterized protein LOC100796... 59 5e-07 ref|XP_006367462.1| PREDICTED: nogo-B receptor-like isoform X2 [... 59 5e-07 ref|XP_006367461.1| PREDICTED: nogo-B receptor-like isoform X1 [... 59 5e-07 ref|XP_007042755.1| Undecaprenyl pyrophosphate synthetase family... 59 5e-07 ref|XP_003558589.1| PREDICTED: nogo-B receptor-like [Brachypodiu... 59 5e-07 >ref|XP_007200332.1| hypothetical protein PRUPE_ppa010395mg [Prunus persica] gi|462395732|gb|EMJ01531.1| hypothetical protein PRUPE_ppa010395mg [Prunus persica] Length = 251 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK-KNCCLNRNK 226 RYLAIV+ESEEA+ TS+V +LL+WL IGVK CLYDT+G +K K LN+ K Sbjct: 67 RYLAIVIESEEAYQTSKVIELLQWLEAIGVKRVCLYDTEGVLKKSKEAILNKLK 120 >ref|XP_007199960.1| hypothetical protein PRUPE_ppa026313mg, partial [Prunus persica] gi|462395360|gb|EMJ01159.1| hypothetical protein PRUPE_ppa026313mg, partial [Prunus persica] Length = 205 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK-KNCCLNR 220 RYLAIV+ESEEA+ TS+V +LL+WL IGVK CLYDT+G +K K LN+ Sbjct: 56 RYLAIVIESEEAYQTSKVIELLQWLEAIGVKRVCLYDTEGVLKKSKEAILNK 107 >ref|XP_003631634.1| PREDICTED: nogo-B receptor-like isoform 1 [Vitis vinifera] gi|359475284|ref|XP_003631635.1| PREDICTED: nogo-B receptor-like isoform 2 [Vitis vinifera] gi|297741434|emb|CBI32565.3| unnamed protein product [Vitis vinifera] Length = 255 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEAH +V +LL WL TIGVKH CLYD +G +K Sbjct: 68 RYLAIVIESEEAHQIPKVIELLNWLATIGVKHVCLYDNEGVLKK 111 >emb|CAN70934.1| hypothetical protein VITISV_032483 [Vitis vinifera] Length = 199 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEAH +V +LL WL TIGVKH CLYD +G +K Sbjct: 71 RYLAIVIESEEAHQIPKVIELLNWLATIGVKHVCLYDNEGVLKK 114 >gb|EXB63592.1| hypothetical protein L484_026931 [Morus notabilis] Length = 302 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIVVESEEA+ TSR+ +LL WL IGVK+ CLYD +G +K Sbjct: 144 RYLAIVVESEEAYQTSRIIKLLLWLEAIGVKYICLYDAEGVMKK 187 >ref|XP_003610809.1| Nogo-B receptor [Medicago truncatula] gi|355512144|gb|AES93767.1| Nogo-B receptor [Medicago truncatula] Length = 287 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESE+AH TS+V QLL+WL ++G+K+ CLYD +G +K Sbjct: 68 RYLAIVIESEDAHQTSKVVQLLQWLDSLGIKNVCLYDMNGVLKK 111 >ref|XP_002519078.1| conserved hypothetical protein [Ricinus communis] gi|223541741|gb|EEF43289.1| conserved hypothetical protein [Ricinus communis] Length = 243 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIVVESE+A+ S V QLL+WL IGVKH CLYD++G +K Sbjct: 59 RYLAIVVESEDAYQISEVLQLLQWLEAIGVKHLCLYDSEGVLKK 102 >ref|XP_004299106.1| PREDICTED: nogo-B receptor-like [Fragaria vesca subsp. vesca] Length = 230 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIVVESE+A++TS+V +LL+WL IGVK CLYDT+G +K Sbjct: 43 RYLAIVVESEDAYETSKVIELLQWLEAIGVKCVCLYDTEGVLKK 86 >ref|XP_002305421.2| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] gi|566166793|ref|XP_006384502.1| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] gi|550341135|gb|EEE85932.2| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] gi|550341136|gb|ERP62299.1| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] Length = 255 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ES++A S+V QLL+WL IGVKH CLYDT+G +K Sbjct: 68 RYLAIVIESDDACRISKVIQLLQWLQAIGVKHLCLYDTEGVLKK 111 >ref|XP_006384501.1| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] gi|550341134|gb|ERP62298.1| hypothetical protein POPTR_0004s16020g [Populus trichocarpa] Length = 201 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ES++A S+V QLL+WL IGVKH CLYDT+G +K Sbjct: 68 RYLAIVIESDDACRISKVIQLLQWLQAIGVKHLCLYDTEGVLKK 111 >ref|XP_003610814.1| Nogo-B receptor [Medicago truncatula] gi|355512149|gb|AES93772.1| Nogo-B receptor [Medicago truncatula] Length = 263 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 +YLAIV+ESE+AH TS+V QLL+WL ++G+K+ CLYD +G +K Sbjct: 49 QYLAIVIESEDAHQTSKVVQLLQWLDSLGIKNVCLYDMNGVLKK 92 >ref|XP_006423225.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|557525159|gb|ESR36465.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] Length = 289 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEA+ V QLL+WL+ IGVKH CLYD +G +K Sbjct: 68 RYLAIVIESEEAYHIPAVIQLLQWLVDIGVKHVCLYDAEGILKK 111 >ref|XP_006423223.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|567861140|ref|XP_006423224.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|568867710|ref|XP_006487176.1| PREDICTED: nogo-B receptor-like isoform X1 [Citrus sinensis] gi|568867712|ref|XP_006487177.1| PREDICTED: nogo-B receptor-like isoform X2 [Citrus sinensis] gi|568867714|ref|XP_006487178.1| PREDICTED: nogo-B receptor-like isoform X3 [Citrus sinensis] gi|557525157|gb|ESR36463.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|557525158|gb|ESR36464.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] Length = 255 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEA+ V QLL+WL+ IGVKH CLYD +G +K Sbjct: 68 RYLAIVIESEEAYHIPAVIQLLQWLVDIGVKHVCLYDAEGILKK 111 >ref|XP_006423222.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|567861144|ref|XP_006423226.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|557525156|gb|ESR36462.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] gi|557525160|gb|ESR36466.1| hypothetical protein CICLE_v10028976mg [Citrus clementina] Length = 226 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEA+ V QLL+WL+ IGVKH CLYD +G +K Sbjct: 68 RYLAIVIESEEAYHIPAVIQLLQWLVDIGVKHVCLYDAEGILKK 111 >ref|XP_004511413.1| PREDICTED: nogo-B receptor-like [Cicer arietinum] Length = 255 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 +YLAIV+ESE+AH TS+V +LL+WL ++GVK+ CLYD +G +K Sbjct: 68 QYLAIVIESEDAHQTSKVVKLLQWLDSLGVKNVCLYDMNGVLKK 111 >ref|XP_006572869.1| PREDICTED: uncharacterized protein LOC100796301 isoform X1 [Glycine max] Length = 251 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIV+ESEEA+ SRV +LL+WL IGVK+ CLYD +G +K Sbjct: 65 RYLAIVIESEEAYQISRVVKLLQWLDIIGVKNVCLYDMNGVLKK 108 >ref|XP_006367462.1| PREDICTED: nogo-B receptor-like isoform X2 [Solanum tuberosum] Length = 250 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREKKNCCL 214 RYLA+V++SEEA +TS+V +LL WL +IGVK CLYD +G +K + Sbjct: 68 RYLAVVIDSEEARETSKVLELLCWLASIGVKSICLYDREGVLKKSQTAI 116 >ref|XP_006367461.1| PREDICTED: nogo-B receptor-like isoform X1 [Solanum tuberosum] Length = 251 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/49 (53%), Positives = 36/49 (73%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREKKNCCL 214 RYLA+V++SEEA +TS+V +LL WL +IGVK CLYD +G +K + Sbjct: 68 RYLAVVIDSEEARETSKVLELLCWLASIGVKSICLYDREGVLKKSQTAI 116 >ref|XP_007042755.1| Undecaprenyl pyrophosphate synthetase family protein, putative [Theobroma cacao] gi|508706690|gb|EOX98586.1| Undecaprenyl pyrophosphate synthetase family protein, putative [Theobroma cacao] Length = 255 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 RYLAIVVES++A TS++ +LL+WL +GVKH CLYD +G +K Sbjct: 68 RYLAIVVESKDACQTSKIIELLQWLADVGVKHVCLYDMEGILKK 111 >ref|XP_003558589.1| PREDICTED: nogo-B receptor-like [Brachypodium distachyon] Length = 279 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/44 (61%), Positives = 35/44 (79%) Frame = +2 Query: 68 RYLAIVVESEEAHDTSRVTQLLRWLMTIGVKHFCLYDTDGSREK 199 +YLAIVV+S EA++ ++ QLL WL TIGVKH CLYD DG+ +K Sbjct: 86 KYLAIVVDSREANNAVKLKQLLCWLSTIGVKHVCLYDIDGAIKK 129