BLASTX nr result
ID: Cocculus23_contig00016894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00016894 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299438.2| hypothetical protein POPTR_0001s11190g [Popu... 60 2e-07 >ref|XP_002299438.2| hypothetical protein POPTR_0001s11190g [Populus trichocarpa] gi|550347004|gb|EEE84243.2| hypothetical protein POPTR_0001s11190g [Populus trichocarpa] Length = 353 Score = 60.5 bits (145), Expect(2) = 2e-07 Identities = 35/99 (35%), Positives = 48/99 (48%), Gaps = 35/99 (35%) Frame = +1 Query: 94 KRF*RAIASRELSKLIEPWEAWCLKP-----------------FVEFNTAIPFF*SI--- 213 K F RA+AS ELSKL+EPW+ W LK V+ + FF S+ Sbjct: 105 KHFQRAVASGELSKLVEPWDPWWLKKEPDLFSHLPKRKHHHHMMVQGTNLVRFFLSLIPP 164 Query: 214 ---------------HLINVVYNYCFTLQLYDGEWHSDA 285 HL +++Y+YCFT +LY+G+W SDA Sbjct: 165 VRKLVSREPSPFLAYHLGDIIYSYCFTQRLYNGDWQSDA 203 Score = 20.4 bits (41), Expect(2) = 2e-07 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 62 LSFDDLSGEEINVFE 106 ++FDDLS EE F+ Sbjct: 94 INFDDLSAEEKKHFQ 108