BLASTX nr result
ID: Cocculus23_contig00016868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00016868 (236 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI35396.3| unnamed protein product [Vitis vinifera] 114 1e-23 emb|CAN62056.1| hypothetical protein VITISV_027967 [Vitis vinifera] 114 1e-23 ref|XP_006847797.1| hypothetical protein AMTR_s00029p00026560 [A... 92 8e-17 ref|XP_006659013.1| PREDICTED: B3 domain-containing protein IDEF... 80 4e-13 ref|NP_001060757.1| Os08g0101000 [Oryza sativa Japonica Group] g... 78 1e-12 tpd|FAA00380.1| TPA: transcription factor IDEF1 [Oryza sativa Ja... 78 1e-12 gb|EAZ05270.1| hypothetical protein OsI_27472 [Oryza sativa Indi... 78 1e-12 gb|AEX88464.1| iron deficiency-responsive cis-acting element-bin... 77 3e-12 gb|EMT15081.1| hypothetical protein F775_24378 [Aegilops tauschii] 76 4e-12 ref|XP_002448770.1| hypothetical protein SORBIDRAFT_06g032870 [S... 72 6e-11 ref|XP_003579476.1| PREDICTED: putative B3 domain-containing pro... 72 8e-11 ref|XP_004974288.1| PREDICTED: B3 domain-containing protein IDEF... 70 2e-10 ref|XP_004963379.1| PREDICTED: putative B3 domain-containing pro... 70 2e-10 tpg|DAA35358.1| TPA: putative B3 DNA binding domain family prote... 69 5e-10 tpg|DAA35357.1| TPA: putative B3 DNA binding domain family prote... 69 5e-10 gb|AFW74191.1| putative B3 DNA binding domain family protein, pa... 69 5e-10 ref|XP_002893519.1| leafy cotyledon 2 [Arabidopsis lyrata subsp.... 69 5e-10 ref|XP_002444849.1| hypothetical protein SORBIDRAFT_07g000220 [S... 69 5e-10 ref|NP_001152398.1| B3 DNA binding domain containing protein [Ze... 69 5e-10 gb|ACF88143.1| unknown [Zea mays] gi|408690352|gb|AFU81636.1| AB... 69 5e-10 >emb|CBI35396.3| unnamed protein product [Vitis vinifera] Length = 305 Score = 114 bits (285), Expect = 1e-23 Identities = 55/78 (70%), Positives = 65/78 (83%) Frame = -1 Query: 236 EIQSGCRPSASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLV 57 E + G P A+ H ED++EI+GKGW +LVQKELRNTDVGNLGRI+LPKKDAEANLP LV Sbjct: 135 ETRPGSSPPANIH--EDDEEIKGKGWLMLVQKELRNTDVGNLGRIVLPKKDAEANLPPLV 192 Query: 56 AKDGLILHMEDMTLSIDW 3 AKDGL+L MEDM S++W Sbjct: 193 AKDGLVLQMEDMKYSVNW 210 >emb|CAN62056.1| hypothetical protein VITISV_027967 [Vitis vinifera] Length = 346 Score = 114 bits (285), Expect = 1e-23 Identities = 55/78 (70%), Positives = 65/78 (83%) Frame = -1 Query: 236 EIQSGCRPSASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLV 57 E + G P A+ H ED++EI+GKGW +LVQKELRNTDVGNLGRI+LPKKDAEANLP LV Sbjct: 264 ETRPGSSPPANIH--EDDEEIKGKGWLMLVQKELRNTDVGNLGRIVLPKKDAEANLPPLV 321 Query: 56 AKDGLILHMEDMTLSIDW 3 AKDGL+L MEDM S++W Sbjct: 322 AKDGLVLQMEDMKYSVNW 339 >ref|XP_006847797.1| hypothetical protein AMTR_s00029p00026560 [Amborella trichopoda] gi|548851102|gb|ERN09378.1| hypothetical protein AMTR_s00029p00026560 [Amborella trichopoda] Length = 563 Score = 92.0 bits (227), Expect = 8e-17 Identities = 46/78 (58%), Positives = 59/78 (75%), Gaps = 6/78 (7%) Frame = -1 Query: 218 RPSASSHQ------SEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLV 57 RPS+S H+ ++D+KE+E KG + ++KELRN+DVGNLGRI+LPKKDAEANLP L Sbjct: 347 RPSSSRHKVAAENLAKDDKELEVKGLMLALRKELRNSDVGNLGRIVLPKKDAEANLPLLT 406 Query: 56 AKDGLILHMEDMTLSIDW 3 ++G ILHMEDM S W Sbjct: 407 EREGQILHMEDMDSSAVW 424 >ref|XP_006659013.1| PREDICTED: B3 domain-containing protein IDEF1-like [Oryza brachyantha] Length = 364 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/70 (51%), Positives = 51/70 (72%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S SH+S K + + V+++KEL +DVGN+GRI+LPKKDAEA+LP L+ +D +ILH Sbjct: 234 SKQSHESRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPMILH 293 Query: 32 MEDMTLSIDW 3 M+DM L + W Sbjct: 294 MDDMVLPVTW 303 >ref|NP_001060757.1| Os08g0101000 [Oryza sativa Japonica Group] gi|75133116|sp|Q6Z1Z3.1|IDEF1_ORYSJ RecName: Full=B3 domain-containing protein IDEF1; AltName: Full=Protein IRON DEFICIENCY-RESPONSIVE ELEMENT FACTOR 1 gi|38637288|dbj|BAD03551.1| transcription factor viviparous 1-like [Oryza sativa Japonica Group] gi|113622726|dbj|BAF22671.1| Os08g0101000 [Oryza sativa Japonica Group] gi|222639758|gb|EEE67890.1| hypothetical protein OsJ_25718 [Oryza sativa Japonica Group] Length = 362 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/70 (51%), Positives = 49/70 (70%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S H S K + + V+++KEL +DVGN+GRI+LPKKDAEA+LP L+ +D LILH Sbjct: 232 SKQGHDSRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPLILH 291 Query: 32 MEDMTLSIDW 3 M+DM L + W Sbjct: 292 MDDMVLPVTW 301 >tpd|FAA00380.1| TPA: transcription factor IDEF1 [Oryza sativa Japonica Group] Length = 362 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/70 (51%), Positives = 49/70 (70%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S H S K + + V+++KEL +DVGN+GRI+LPKKDAEA+LP L+ +D LILH Sbjct: 232 SKQGHDSRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPLILH 291 Query: 32 MEDMTLSIDW 3 M+DM L + W Sbjct: 292 MDDMVLPVTW 301 >gb|EAZ05270.1| hypothetical protein OsI_27472 [Oryza sativa Indica Group] Length = 413 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/70 (51%), Positives = 49/70 (70%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S H S K + + V+++KEL +DVGN+GRI+LPKKDAEA+LP L+ +D LILH Sbjct: 229 SKQGHDSRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPLILH 288 Query: 32 MEDMTLSIDW 3 M+DM L + W Sbjct: 289 MDDMVLPVTW 298 >gb|AEX88464.1| iron deficiency-responsive cis-acting element-binding factor 1 [Oryza coarctata] gi|372126552|gb|AEX88465.1| iron deficiency-responsive cis-acting element-binding factor 1 [Oryza coarctata] Length = 346 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/66 (51%), Positives = 49/66 (74%) Frame = -1 Query: 200 HQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDM 21 H+S K + + V+++KEL +DVGN+GRI+LPKKDAEA+LP L+ +D +ILHM+DM Sbjct: 220 HESRATKLLNSGEYQVILRKELTKSDVGNVGRIVLPKKDAEASLPPLLQRDPVILHMDDM 279 Query: 20 TLSIDW 3 L + W Sbjct: 280 VLPVTW 285 >gb|EMT15081.1| hypothetical protein F775_24378 [Aegilops tauschii] Length = 305 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/55 (61%), Positives = 45/55 (81%) Frame = -1 Query: 167 KGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 K + ++V KEL N+DVGN+GRI++PK+DAEANLP L+ +DGLIL MEDM L + W Sbjct: 179 KDYHMIVWKELTNSDVGNIGRIVVPKRDAEANLPALLERDGLILKMEDMRLPVTW 233 >ref|XP_002448770.1| hypothetical protein SORBIDRAFT_06g032870 [Sorghum bicolor] gi|241939953|gb|EES13098.1| hypothetical protein SORBIDRAFT_06g032870 [Sorghum bicolor] Length = 434 Score = 72.4 bits (176), Expect = 6e-11 Identities = 34/68 (50%), Positives = 48/68 (70%) Frame = -1 Query: 206 SSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHME 27 + H S K++ + + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+ Sbjct: 281 NGHISFTNKKVNCQDYRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMD 340 Query: 26 DMTLSIDW 3 D L W Sbjct: 341 DFELPAVW 348 >ref|XP_003579476.1| PREDICTED: putative B3 domain-containing protein Os04g0676650-like [Brachypodium distachyon] Length = 398 Score = 72.0 bits (175), Expect = 8e-11 Identities = 31/55 (56%), Positives = 44/55 (80%) Frame = -1 Query: 167 KGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 K + ++++K+L N+DVGN+GRI+LPK+DAEANLP L+ +DGLIL M+D L W Sbjct: 258 KEYHIVLRKDLTNSDVGNIGRIVLPKRDAEANLPALLERDGLILQMDDFNLVATW 312 >ref|XP_004974288.1| PREDICTED: B3 domain-containing protein IDEF1-like [Setaria italica] Length = 396 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/70 (52%), Positives = 49/70 (70%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S SH+S K G+ + V+++KEL +DV N+GRI+LPKKDAEA+LP LV D LIL Sbjct: 269 SKPSHESCTTKFNSGE-YQVVLRKELTKSDVANVGRIVLPKKDAEASLPPLVQGDPLILQ 327 Query: 32 MEDMTLSIDW 3 M+DM L + W Sbjct: 328 MDDMVLPVTW 337 >ref|XP_004963379.1| PREDICTED: putative B3 domain-containing protein Os04g0676650-like [Setaria italica] Length = 432 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/60 (53%), Positives = 44/60 (73%) Frame = -1 Query: 182 KEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 K + + + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+D L W Sbjct: 287 KTVNCQDYRIILRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPAVW 346 >tpg|DAA35358.1| TPA: putative B3 DNA binding domain family protein [Zea mays] Length = 439 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -1 Query: 161 WTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+D L + W Sbjct: 300 YRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVW 352 >tpg|DAA35357.1| TPA: putative B3 DNA binding domain family protein [Zea mays] Length = 449 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -1 Query: 161 WTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+D L + W Sbjct: 310 YRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVW 362 >gb|AFW74191.1| putative B3 DNA binding domain family protein, partial [Zea mays] Length = 313 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/70 (54%), Positives = 47/70 (67%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S SH+S K G+ + V+++KEL +DV N GRI+LPKKDAEA LP LV D LIL Sbjct: 211 SKQSHESCASKFDSGE-YQVILRKELTKSDVANSGRIVLPKKDAEAGLPPLVQGDPLILQ 269 Query: 32 MEDMTLSIDW 3 M+DM L I W Sbjct: 270 MDDMVLPIIW 279 >ref|XP_002893519.1| leafy cotyledon 2 [Arabidopsis lyrata subsp. lyrata] gi|297339361|gb|EFH69778.1| leafy cotyledon 2 [Arabidopsis lyrata subsp. lyrata] Length = 361 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/64 (50%), Positives = 45/64 (70%) Frame = -1 Query: 194 SEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTL 15 S + + K VL +KEL+N+DVG+LGRI+LPK+DAEANLP+L K+G++L M D+ Sbjct: 155 SYQQSTFDNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVLEMRDVFS 214 Query: 14 SIDW 3 W Sbjct: 215 MQSW 218 >ref|XP_002444849.1| hypothetical protein SORBIDRAFT_07g000220 [Sorghum bicolor] gi|241941199|gb|EES14344.1| hypothetical protein SORBIDRAFT_07g000220 [Sorghum bicolor] Length = 351 Score = 69.3 bits (168), Expect = 5e-10 Identities = 38/70 (54%), Positives = 47/70 (67%) Frame = -1 Query: 212 SASSHQSEDEKEIEGKGWTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILH 33 S SH+S K G+ + V+++KEL +DV N GRI+LPKKDAEA LP LV D LIL Sbjct: 224 SKQSHESCASKFNSGE-YQVILRKELTKSDVANSGRIVLPKKDAEAGLPPLVQGDPLILQ 282 Query: 32 MEDMTLSIDW 3 M+DM L I W Sbjct: 283 MDDMVLPIIW 292 >ref|NP_001152398.1| B3 DNA binding domain containing protein [Zea mays] gi|195655865|gb|ACG47400.1| B3 DNA binding domain containing protein [Zea mays] Length = 440 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -1 Query: 161 WTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+D L + W Sbjct: 301 YRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVW 353 >gb|ACF88143.1| unknown [Zea mays] gi|408690352|gb|AFU81636.1| ABI3VP1-type transcription factor, partial [Zea mays subsp. mays] Length = 439 Score = 69.3 bits (168), Expect = 5e-10 Identities = 31/53 (58%), Positives = 42/53 (79%) Frame = -1 Query: 161 WTVLVQKELRNTDVGNLGRIILPKKDAEANLPQLVAKDGLILHMEDMTLSIDW 3 + ++++K+L N+DVGN+GRI+LPKKDAE NLP L KDGLIL M+D L + W Sbjct: 300 YRMVLRKDLTNSDVGNIGRIVLPKKDAEPNLPILEDKDGLILEMDDFELPVVW 352