BLASTX nr result
ID: Cocculus23_contig00016599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00016599 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289314.1| PREDICTED: putative BTB/POZ domain-containin... 72 6e-11 gb|AFZ78666.1| transposase [Populus tomentosa] 70 3e-10 ref|XP_002309978.2| hypothetical protein POPTR_0007s05440g [Popu... 69 5e-10 ref|XP_002306309.2| hypothetical protein POPTR_0005s07690g, part... 69 9e-10 ref|XP_002262774.2| PREDICTED: putative BTB/POZ domain-containin... 68 2e-09 emb|CBI25777.3| unnamed protein product [Vitis vinifera] 68 2e-09 ref|XP_006355618.1| PREDICTED: putative BTB/POZ domain-containin... 66 4e-09 ref|XP_002531260.1| Root phototropism protein, putative [Ricinus... 65 1e-08 ref|XP_006428195.1| hypothetical protein CICLE_v10025174mg [Citr... 63 5e-08 ref|XP_006428194.1| hypothetical protein CICLE_v10025174mg [Citr... 63 5e-08 ref|XP_006428193.1| hypothetical protein CICLE_v10025174mg [Citr... 63 5e-08 ref|XP_007207903.1| hypothetical protein PRUPE_ppa020832mg [Prun... 61 1e-07 ref|XP_006853126.1| hypothetical protein AMTR_s00038p00155420 [A... 61 2e-07 ref|XP_007047953.1| Root phototropism protein, putative [Theobro... 61 2e-07 emb|CBI41104.3| unnamed protein product [Vitis vinifera] 61 2e-07 ref|XP_006399519.1| hypothetical protein EUTSA_v10015906mg [Eutr... 60 2e-07 ref|XP_004240016.1| PREDICTED: putative BTB/POZ domain-containin... 59 5e-07 gb|AAZ67606.1| 80A08_21 [Brassica rapa subsp. pekinensis] 59 5e-07 gb|EXB29446.1| Putative BTB/POZ domain-containing protein DOT3 [... 59 7e-07 ref|XP_003635572.1| PREDICTED: putative BTB/POZ domain-containin... 58 1e-06 >ref|XP_004289314.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Fragaria vesca subsp. vesca] Length = 623 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/72 (44%), Positives = 49/72 (68%) Frame = -1 Query: 216 MKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLT 37 MK+ L TQ +++ +D S + +P+K + +AD FEK + SWF TS++PTDLT Sbjct: 1 MKKSLTTTQNPGSHYNRSDQLHDQSIVIPANPSKLINLADSFEKKEHSWFITSHVPTDLT 60 Query: 36 IQVEDITFHVHK 1 +QV++ITF+VHK Sbjct: 61 VQVQEITFNVHK 72 >gb|AFZ78666.1| transposase [Populus tomentosa] Length = 637 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/78 (47%), Positives = 47/78 (60%) Frame = -1 Query: 234 YSMRITMKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSN 55 Y + +TMK+ L Q +S S D D A N +V PT + I D F+K D SW TS Sbjct: 10 YILIVTMKKSLLVVQSQSSESDS-DGTDQAHNQSIVVPTTVIAIGDSFQKKDNSWVVTSQ 68 Query: 54 IPTDLTIQVEDITFHVHK 1 I TDL+IQV+D+TF VHK Sbjct: 69 IATDLSIQVQDVTFTVHK 86 >ref|XP_002309978.2| hypothetical protein POPTR_0007s05440g [Populus trichocarpa] gi|550334186|gb|EEE90428.2| hypothetical protein POPTR_0007s05440g [Populus trichocarpa] Length = 637 Score = 69.3 bits (168), Expect = 5e-10 Identities = 37/78 (47%), Positives = 47/78 (60%) Frame = -1 Query: 234 YSMRITMKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSN 55 Y + +TMK+ L Q +S S D D A N +V PT + IAD +K D SW TS Sbjct: 10 YILIVTMKKSLLVVQSQSSESDS-DGTDQAHNQSIVVPTTVIAIADSIQKKDNSWVVTSQ 68 Query: 54 IPTDLTIQVEDITFHVHK 1 I TDL+IQV+D+TF VHK Sbjct: 69 IATDLSIQVQDVTFTVHK 86 >ref|XP_002306309.2| hypothetical protein POPTR_0005s07690g, partial [Populus trichocarpa] gi|550338343|gb|EEE93305.2| hypothetical protein POPTR_0005s07690g, partial [Populus trichocarpa] Length = 591 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/77 (48%), Positives = 46/77 (59%) Frame = -1 Query: 231 SMRITMKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNI 52 S +TMK+ L + +S S D N ++ P + IAD FEKND SWF S I Sbjct: 4 SSTVTMKKSLPLVKSQSSESDS-GGVDQVYNQSIIVPPTAMSIADGFEKNDHSWFVNSPI 62 Query: 51 PTDLTIQVEDITFHVHK 1 PTDL+IQV+DITF VHK Sbjct: 63 PTDLSIQVQDITFTVHK 79 >ref|XP_002262774.2| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like, partial [Vitis vinifera] Length = 571 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = -1 Query: 165 TDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 +D D + +V P+K V IAD FEK + SWF TS +PTDLTIQV+DITF+ HK Sbjct: 17 SDYNDQVHDQSIVVPSKLVTIADSFEKKEHSWFVTSQVPTDLTIQVQDITFYAHK 71 >emb|CBI25777.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = -1 Query: 165 TDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 +D D + +V P+K V IAD FEK + SWF TS +PTDLTIQV+DITF+ HK Sbjct: 17 SDYNDQVHDQSIVVPSKLVTIADSFEKKEHSWFVTSQVPTDLTIQVQDITFYAHK 71 >ref|XP_006355618.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Solanum tuberosum] Length = 622 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/72 (43%), Positives = 47/72 (65%) Frame = -1 Query: 216 MKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLT 37 M++++ + Q+ + H +D + +V PT IAD F K +KSWF TS +P+DL+ Sbjct: 1 MQKLILDGQENTSDHHESDENHQNHDQCIVVPTMLNAIADGFIKKEKSWFATSQLPSDLS 60 Query: 36 IQVEDITFHVHK 1 I+VEDITF+VHK Sbjct: 61 IRVEDITFYVHK 72 >ref|XP_002531260.1| Root phototropism protein, putative [Ricinus communis] gi|223529145|gb|EEF31124.1| Root phototropism protein, putative [Ricinus communis] Length = 643 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -1 Query: 153 DHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 DH + ++ PTK V D FEK + SWF TS IPTDL++QV+DITF VHK Sbjct: 38 DHGHDKSIIIPTKVVATTDIFEKKEDSWFVTSQIPTDLSVQVQDITFTVHK 88 >ref|XP_006428195.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] gi|568819384|ref|XP_006464233.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like isoform X1 [Citrus sinensis] gi|557530185|gb|ESR41435.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] Length = 621 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -1 Query: 165 TDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 ++ + A +V P + + IAD FEK + SWF TS IPTDL+IQV+D+TF VHK Sbjct: 16 SEGSGQACEQSIVIPNRFITIADSFEKKEHSWFVTSQIPTDLSIQVQDVTFTVHK 70 >ref|XP_006428194.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] gi|568819386|ref|XP_006464234.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like isoform X2 [Citrus sinensis] gi|557530184|gb|ESR41434.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] Length = 595 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -1 Query: 165 TDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 ++ + A +V P + + IAD FEK + SWF TS IPTDL+IQV+D+TF VHK Sbjct: 16 SEGSGQACEQSIVIPNRFITIADSFEKKEHSWFVTSQIPTDLSIQVQDVTFTVHK 70 >ref|XP_006428193.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] gi|557530183|gb|ESR41433.1| hypothetical protein CICLE_v10025174mg [Citrus clementina] Length = 571 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = -1 Query: 165 TDAADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 ++ + A +V P + + IAD FEK + SWF TS IPTDL+IQV+D+TF VHK Sbjct: 16 SEGSGQACEQSIVIPNRFITIADSFEKKEHSWFVTSQIPTDLSIQVQDVTFTVHK 70 >ref|XP_007207903.1| hypothetical protein PRUPE_ppa020832mg [Prunus persica] gi|462403545|gb|EMJ09102.1| hypothetical protein PRUPE_ppa020832mg [Prunus persica] Length = 507 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -1 Query: 132 VVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 +V P+K + IA+ FEK + SWF TS++ TDLTIQV+D+TF+VHK Sbjct: 23 IVIPSKHITIANTFEKKEHSWFITSHVSTDLTIQVQDVTFNVHK 66 >ref|XP_006853126.1| hypothetical protein AMTR_s00038p00155420 [Amborella trichopoda] gi|548856765|gb|ERN14593.1| hypothetical protein AMTR_s00038p00155420 [Amborella trichopoda] Length = 666 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -1 Query: 159 AADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 + D A VVS +KR+ +A+ FE+ SWF S+IPTDLTI+VED+TF +HK Sbjct: 18 SGDGADLRAVVSSSKRMVVAESFEREGNSWFVNSHIPTDLTIKVEDVTFLLHK 70 >ref|XP_007047953.1| Root phototropism protein, putative [Theobroma cacao] gi|508700214|gb|EOX92110.1| Root phototropism protein, putative [Theobroma cacao] Length = 625 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Frame = -1 Query: 216 MKEMLQNTQQESLYFHSTDAADH-ASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDL 40 MK+ LQ Q S +DH A + ++ P K + +AD E+ + SWF TS IPTDL Sbjct: 1 MKKSLQMAQPRSPGGSDAGGSDHQAYDQSIIVPNKLITVADSLERKELSWFATSQIPTDL 60 Query: 39 TIQVEDITFHVHK 1 IQV++ F+VHK Sbjct: 61 AIQVQEAIFNVHK 73 >emb|CBI41104.3| unnamed protein product [Vitis vinifera] Length = 459 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 123 PTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 P+K V IAD EK + SWF TS +PTDLTIQV+DITF+ HK Sbjct: 1 PSKLVTIADSLEKKEHSWFVTSQVPTDLTIQVQDITFYAHK 41 >ref|XP_006399519.1| hypothetical protein EUTSA_v10015906mg [Eutrema salsugineum] gi|557100609|gb|ESQ40972.1| hypothetical protein EUTSA_v10015906mg [Eutrema salsugineum] Length = 578 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = -1 Query: 156 ADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 AD N +V P + V +A+ FEK D+SW+ S IP+DL+IQV+DITF HK Sbjct: 18 ADQICNKSIVIPNRIVTLANSFEKKDRSWYVKSQIPSDLSIQVDDITFQAHK 69 >ref|XP_004240016.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Solanum lycopersicum] Length = 624 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/67 (46%), Positives = 40/67 (59%), Gaps = 3/67 (4%) Frame = -1 Query: 192 QQESLYFHSTDAADHASNH---VVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVED 22 +QE H H H +VV PT IAD F K +KSW TS +P+DL+I+VED Sbjct: 8 EQEGTSDHPESNESHHQVHDDQLVVVPTMLNAIADGFVKKEKSWSATSQLPSDLSIRVED 67 Query: 21 ITFHVHK 1 ITF++HK Sbjct: 68 ITFYIHK 74 >gb|AAZ67606.1| 80A08_21 [Brassica rapa subsp. pekinensis] Length = 630 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/52 (51%), Positives = 34/52 (65%) Frame = -1 Query: 156 ADHASNHVVVSPTKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 AD N +V P + V +A+ FEK D+SW+ S IP DL+IQV DITF HK Sbjct: 19 ADKVCNKSIVVPHRVVALANSFEKKDRSWYVKSQIPNDLSIQVNDITFQAHK 70 >gb|EXB29446.1| Putative BTB/POZ domain-containing protein DOT3 [Morus notabilis] Length = 621 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = -1 Query: 216 MKEMLQNTQQESLYFHSTDAADHASNHVVVSPTKRVG-IADRFEKNDKSWFPTSNIPTDL 40 MK+ L Q F TD HA H +V P+K + I D E+ + SWF TS IP DL Sbjct: 1 MKKALNRPQSPGSDFDGTDQV-HA--HSIVLPSKFITTICDSLERKEPSWFITSQIPKDL 57 Query: 39 TIQVEDITFHVHK 1 +IQVE++TF+VHK Sbjct: 58 SIQVEEVTFNVHK 70 >ref|XP_003635572.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like, partial [Vitis vinifera] Length = 556 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -1 Query: 120 TKRVGIADRFEKNDKSWFPTSNIPTDLTIQVEDITFHVHK 1 +K V IAD EK + SWF TS +PTDLTIQV+DITF+ HK Sbjct: 1 SKLVTIADSLEKKEHSWFVTSQVPTDLTIQVQDITFYAHK 40