BLASTX nr result
ID: Cocculus23_contig00016581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00016581 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522372.1| GTP-binding protein alpha subunit, gna, put... 56 6e-06 >ref|XP_002522372.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223538450|gb|EEF40056.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 917 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = -3 Query: 243 PENEEEIEYSFALEYKGPPLLCDDDLPRALPIDVNRXXXXXXXXXXXXXXSNQLSFPVVH 64 P+NE+ ++YSFALEY GPPL DLPRA+PI+VN+ ++LS PVV Sbjct: 3 PDNEDGVQYSFALEYNGPPL--PYDLPRAVPINVNK--IPVAAVVSQLSIPDKLSLPVVK 58 Query: 63 PLL 55 PLL Sbjct: 59 PLL 61