BLASTX nr result
ID: Cocculus23_contig00016523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00016523 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007140517.1| hypothetical protein PHAVU_008G119400g [Phas... 82 1e-13 ref|XP_003530211.2| PREDICTED: probable WRKY transcription facto... 80 3e-13 ref|XP_006341213.1| PREDICTED: probable WRKY transcription facto... 80 4e-13 ref|XP_004246870.1| PREDICTED: probable WRKY transcription facto... 80 4e-13 ref|XP_004514387.1| PREDICTED: probable WRKY transcription facto... 79 7e-13 gb|EXC14783.1| putative WRKY transcription factor 49 [Morus nota... 79 9e-13 ref|XP_003551480.2| PREDICTED: probable WRKY transcription facto... 79 9e-13 ref|XP_006480891.1| PREDICTED: probable WRKY transcription facto... 78 1e-12 ref|XP_006429119.1| hypothetical protein CICLE_v10013616mg [Citr... 78 1e-12 ref|XP_004302766.1| PREDICTED: probable WRKY transcription facto... 77 2e-12 ref|XP_007206527.1| hypothetical protein PRUPE_ppa019550mg [Prun... 77 2e-12 ref|XP_002530990.1| WRKY transcription factor, putative [Ricinus... 77 3e-12 ref|XP_002270859.1| PREDICTED: probable WRKY transcription facto... 77 3e-12 gb|AGQ04227.1| WRKY transcription factor 38 [Jatropha curcas] 76 4e-12 ref|XP_002459179.1| hypothetical protein SORBIDRAFT_03g047350 [S... 75 1e-11 ref|XP_006846260.1| hypothetical protein AMTR_s00012p00243090 [A... 74 2e-11 ref|XP_007026988.1| WRKY DNA-binding protein 49, putative [Theob... 74 2e-11 ref|XP_002323509.1| hypothetical protein POPTR_0016s10610g [Popu... 74 2e-11 gb|AER70302.1| WRKY transcription factor [(Populus tomentosa x P... 74 3e-11 ref|XP_003567529.1| PREDICTED: uncharacterized protein LOC100839... 73 4e-11 >ref|XP_007140517.1| hypothetical protein PHAVU_008G119400g [Phaseolus vulgaris] gi|561013650|gb|ESW12511.1| hypothetical protein PHAVU_008G119400g [Phaseolus vulgaris] Length = 311 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQTHKHQ 80 RSYY+CT PRC AKKQVERS +DP+TL+ITYEGLH HFAY L+ Q H+ Q Sbjct: 145 RSYYRCTNPRCSAKKQVERSIEDPDTLIITYEGLHLHFAYPYFLMGQPHQSQ 196 >ref|XP_003530211.2| PREDICTED: probable WRKY transcription factor 49-like [Glycine max] Length = 317 Score = 80.1 bits (196), Expect = 3e-13 Identities = 38/71 (53%), Positives = 47/71 (66%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQTHKHQXXXXXXXX 56 RSYY+CT PRC AKKQVERS++DP+TL+ITYEGLH HFAY L+ Q + Sbjct: 147 RSYYRCTNPRCSAKKQVERSNEDPDTLIITYEGLHLHFAYPYFLMGQQQQSHSYPPIKKS 206 Query: 55 XXXXXKAQNQT 23 +AQ+QT Sbjct: 207 KPTSPQAQDQT 217 >ref|XP_006341213.1| PREDICTED: probable WRKY transcription factor 49-like [Solanum tuberosum] Length = 281 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLL 101 RSYYKCT PRCGAKKQVERSS +PNT +ITYEGLH HFAY + L Sbjct: 136 RSYYKCTNPRCGAKKQVERSSDEPNTFIITYEGLHLHFAYPFITL 180 >ref|XP_004246870.1| PREDICTED: probable WRKY transcription factor 49-like [Solanum lycopersicum] Length = 290 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLL 101 RSYYKCT PRCGAKKQVERSS +PNT +ITYEGLH HFAY + L Sbjct: 135 RSYYKCTNPRCGAKKQVERSSDEPNTFIITYEGLHLHFAYPFITL 179 >ref|XP_004514387.1| PREDICTED: probable WRKY transcription factor 49-like [Cicer arietinum] Length = 295 Score = 79.0 bits (193), Expect = 7e-13 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQT 92 RSYY+CT PRCGAKKQVERS++DP+TL+ITYEGLH HF Y L+ Q+ Sbjct: 143 RSYYRCTNPRCGAKKQVERSNEDPDTLIITYEGLHLHFTYPYFLVGQS 190 >gb|EXC14783.1| putative WRKY transcription factor 49 [Morus notabilis] Length = 316 Score = 78.6 bits (192), Expect = 9e-13 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQT 92 RSYY+CT PRC AKKQVERSS DP+TL+ITYEGLH HF Y +L QT Sbjct: 151 RSYYRCTNPRCSAKKQVERSSDDPDTLIITYEGLHLHFTYPFFILGQT 198 >ref|XP_003551480.2| PREDICTED: probable WRKY transcription factor 49-like [Glycine max] Length = 308 Score = 78.6 bits (192), Expect = 9e-13 Identities = 42/84 (50%), Positives = 50/84 (59%), Gaps = 7/84 (8%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQTHKHQXXXXXXXX 56 RSYY+CT PRC AKKQVERS++DP+TL+ITYEGLH HFAY L+ Q + Sbjct: 145 RSYYRCTNPRCSAKKQVERSNEDPDTLIITYEGLHLHFAYPYFLMGQLQQSNSHPPIKKS 204 Query: 55 XXXXXKAQNQT-------EAQSQA 5 +AQ Q EAQS A Sbjct: 205 KPISPQAQAQAHREDYVQEAQSNA 228 >ref|XP_006480891.1| PREDICTED: probable WRKY transcription factor 49-like [Citrus sinensis] Length = 303 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQ 95 RSYYKCT PRC AKKQVERS DP+TL+ITYEGLH HFAY +L Q Sbjct: 137 RSYYKCTNPRCSAKKQVERSCDDPDTLIITYEGLHLHFAYPYFILNQ 183 >ref|XP_006429119.1| hypothetical protein CICLE_v10013616mg [Citrus clementina] gi|557531176|gb|ESR42359.1| hypothetical protein CICLE_v10013616mg [Citrus clementina] Length = 303 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQ 95 RSYYKCT PRC AKKQVERS DP+TL+ITYEGLH HFAY +L Q Sbjct: 137 RSYYKCTNPRCSAKKQVERSCDDPDTLIITYEGLHLHFAYPYFILNQ 183 >ref|XP_004302766.1| PREDICTED: probable WRKY transcription factor 49-like [Fragaria vesca subsp. vesca] Length = 296 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAY 116 RSYY+CT PRC AKKQVERSS+DP+TL+ITYEGLH HFAY Sbjct: 134 RSYYRCTNPRCSAKKQVERSSEDPDTLIITYEGLHLHFAY 173 >ref|XP_007206527.1| hypothetical protein PRUPE_ppa019550mg [Prunus persica] gi|462402169|gb|EMJ07726.1| hypothetical protein PRUPE_ppa019550mg [Prunus persica] Length = 299 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAY 116 RSYY+CT PRC AKKQVERSS+DP+TL+ITYEGLH HFAY Sbjct: 134 RSYYRCTNPRCSAKKQVERSSEDPDTLIITYEGLHLHFAY 173 >ref|XP_002530990.1| WRKY transcription factor, putative [Ricinus communis] gi|223529442|gb|EEF31402.1| WRKY transcription factor, putative [Ricinus communis] Length = 296 Score = 77.0 bits (188), Expect = 3e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQTH 89 RSYY+CT PRC AKKQVERSS+D +TLVITYEGLH HFAY L+ Q + Sbjct: 137 RSYYRCTNPRCSAKKQVERSSEDQDTLVITYEGLHLHFAYPYFLVDQAN 185 >ref|XP_002270859.1| PREDICTED: probable WRKY transcription factor 49 [Vitis vinifera] gi|297740354|emb|CBI30536.3| unnamed protein product [Vitis vinifera] Length = 299 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLL 101 RSYY+CT PRC AKKQVE+SS+DP+TL+ITYEGLH HFAY L+ Sbjct: 132 RSYYRCTNPRCSAKKQVEKSSEDPDTLIITYEGLHLHFAYPFFLI 176 >gb|AGQ04227.1| WRKY transcription factor 38 [Jatropha curcas] Length = 301 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQ 95 RSYY+CT PRC AKKQVERSS+D +TL+ITYEGLH HFAY L+ Q Sbjct: 139 RSYYRCTNPRCSAKKQVERSSEDQDTLIITYEGLHLHFAYPYFLVDQ 185 >ref|XP_002459179.1| hypothetical protein SORBIDRAFT_03g047350 [Sorghum bicolor] gi|241931154|gb|EES04299.1| hypothetical protein SORBIDRAFT_03g047350 [Sorghum bicolor] Length = 354 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQ 95 RSYY+CT PRC AKKQVERS+++ +TLV+TYEGLH H+ Y++ L PQ Sbjct: 161 RSYYRCTNPRCNAKKQVERSTEEADTLVVTYEGLHLHYTYSHFLQPQ 207 >ref|XP_006846260.1| hypothetical protein AMTR_s00012p00243090 [Amborella trichopoda] gi|548849030|gb|ERN07935.1| hypothetical protein AMTR_s00012p00243090 [Amborella trichopoda] Length = 352 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLL 101 RSYY+CT PRC AKKQVE+S +DP+TLVITYEGLH H+AY++ L Sbjct: 131 RSYYRCTNPRCSAKKQVEKSIEDPDTLVITYEGLHLHYAYSHFQL 175 >ref|XP_007026988.1| WRKY DNA-binding protein 49, putative [Theobroma cacao] gi|508715593|gb|EOY07490.1| WRKY DNA-binding protein 49, putative [Theobroma cacao] Length = 399 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/40 (80%), Positives = 34/40 (85%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAY 116 RSYYKCT PRC AKKQVERS DP+TL+ITYEGLH HF Y Sbjct: 233 RSYYKCTNPRCSAKKQVERSRDDPDTLIITYEGLHLHFPY 272 >ref|XP_002323509.1| hypothetical protein POPTR_0016s10610g [Populus trichocarpa] gi|222868139|gb|EEF05270.1| hypothetical protein POPTR_0016s10610g [Populus trichocarpa] Length = 309 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVLLPQ 95 RSYY+CT RCGAKKQVERSS+DP+TLVITYEGLH HF++ L Q Sbjct: 138 RSYYRCTNRRCGAKKQVERSSEDPDTLVITYEGLHLHFSHPYFLSNQ 184 >gb|AER70302.1| WRKY transcription factor [(Populus tomentosa x Populus bolleana) x Populus tomentosa] Length = 294 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAY 116 RSYYKCT PRCGAKKQVERS +DP+TLVITYEGLH F++ Sbjct: 123 RSYYKCTNPRCGAKKQVERSGEDPDTLVITYEGLHLRFSH 162 >ref|XP_003567529.1| PREDICTED: uncharacterized protein LOC100839602 [Brachypodium distachyon] Length = 373 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/50 (62%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = -1 Query: 235 RSYYKCTIPRCGAKKQVERSSKDPNTLVITYEGLHFHFAYANVL-LPQTH 89 RSYY+CT PRC AKKQVERS+++P+TL++TYEGLH H+ Y++ L P+ H Sbjct: 161 RSYYRCTNPRCNAKKQVERSTEEPDTLLVTYEGLHLHYTYSHFLQKPKLH 210