BLASTX nr result
ID: Cocculus23_contig00015467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00015467 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205788.1| hypothetical protein PRUPE_ppa010549mg [Prun... 69 5e-10 gb|AAF65768.1|AF242310_1 manganese superoxide dismutase [Euphorb... 68 1e-09 gb|AFD50702.1| manganese superoxide dismutase [Suaeda salsa] 68 1e-09 gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] 68 1e-09 sp|P35017.1|SODM_HEVBR RecName: Full=Superoxide dismutase [Mn], ... 68 2e-09 gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] 68 2e-09 emb|CAC13961.1| IgE-binding protein MnSOD [Hevea brasiliensis] 68 2e-09 emb|CAB53458.1| MnSOD [Hevea brasiliensis] 68 2e-09 gb|AFJ42576.1| anganese superoxide dismutase [Sesamum indicum] 67 2e-09 gb|ACO72899.1| superoxide dismutase [Knorringia sibirica] 67 2e-09 ref|XP_002520856.1| superoxide dismutase [mn], putative [Ricinus... 67 2e-09 gb|ABR29644.1| manganese superoxide dismutase-like protein [Pist... 67 2e-09 emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] 67 2e-09 gb|AFD50703.1| manganese superoxide dismutase [Salicornia europaea] 67 3e-09 gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] 67 3e-09 gb|AFD34190.1| Mn superoxide dismutase [Jatropha curcas] 67 3e-09 ref|XP_004240868.1| PREDICTED: superoxide dismutase [Mn], mitoch... 66 4e-09 ref|XP_007011340.1| Superoxide dismutase [Theobroma cacao] gi|50... 66 6e-09 gb|ABI35908.1| manganese superoxide dismutase [Rheum australe] 66 6e-09 sp|P11796.1|SODM_NICPL RecName: Full=Superoxide dismutase [Mn], ... 65 8e-09 >ref|XP_007205788.1| hypothetical protein PRUPE_ppa010549mg [Prunus persica] gi|462401430|gb|EMJ06987.1| hypothetical protein PRUPE_ppa010549mg [Prunus persica] Length = 245 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYASD+Y+KECP Sbjct: 216 YKNVRPDYLKNIWKVINWKYASDVYEKECP 245 >gb|AAF65768.1|AF242310_1 manganese superoxide dismutase [Euphorbia esula] Length = 237 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNVRPDYLKNIWKV+NWKYASD+Y ECPS Sbjct: 206 YKNVRPDYLKNIWKVVNWKYASDIYANECPS 236 >gb|AFD50702.1| manganese superoxide dismutase [Suaeda salsa] Length = 232 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNVRPDYLKNIWKV+NWKYAS++Y+KECPS Sbjct: 201 YKNVRPDYLKNIWKVMNWKYASEVYEKECPS 231 >gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] Length = 228 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYAS++Y+KECP Sbjct: 199 YKNVRPDYLKNIWKVINWKYASEIYEKECP 228 >sp|P35017.1|SODM_HEVBR RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|348137|gb|AAA16792.1| superoxide dismutase (manganese) [Hevea brasiliensis] Length = 233 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPST 177 YKNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 202 YKNVRPDYLKNIWKVMNWKYASEVYAKECPSS 233 >gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] Length = 226 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYAS++Y+KECP Sbjct: 197 YKNVRPDYLKNIWKVINWKYASEVYEKECP 226 >emb|CAC13961.1| IgE-binding protein MnSOD [Hevea brasiliensis] Length = 205 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPST 177 YKNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 174 YKNVRPDYLKNIWKVMNWKYASEVYAKECPSS 205 >emb|CAB53458.1| MnSOD [Hevea brasiliensis] Length = 205 Score = 67.8 bits (164), Expect = 2e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPST 177 YKNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 174 YKNVRPDYLKNIWKVMNWKYASEVYAKECPSS 205 >gb|AFJ42576.1| anganese superoxide dismutase [Sesamum indicum] Length = 225 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKV+NWKYASD+Y KECP Sbjct: 196 YKNVRPDYLKNIWKVMNWKYASDVYDKECP 225 >gb|ACO72899.1| superoxide dismutase [Knorringia sibirica] Length = 234 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNVRPDYL NIWKVINWKYAS+LY+KECP+ Sbjct: 201 YKNVRPDYLNNIWKVINWKYASELYEKECPT 231 >ref|XP_002520856.1| superoxide dismutase [mn], putative [Ricinus communis] gi|223539987|gb|EEF41565.1| superoxide dismutase [mn], putative [Ricinus communis] Length = 234 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNVRPDYLKNIWKV+NWKYAS++Y KECPS Sbjct: 203 YKNVRPDYLKNIWKVMNWKYASEVYAKECPS 233 >gb|ABR29644.1| manganese superoxide dismutase-like protein [Pistacia vera] Length = 230 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYA +LY+KECP Sbjct: 201 YKNVRPDYLKNIWKVINWKYAGELYQKECP 230 >emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] Length = 224 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYAS++Y KECP Sbjct: 195 YKNVRPDYLKNIWKVINWKYASEIYDKECP 224 >gb|AFD50703.1| manganese superoxide dismutase [Salicornia europaea] Length = 232 Score = 67.0 bits (162), Expect = 3e-09 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNV+PDYLKNIWKV+NWKYAS++Y+KECPS Sbjct: 201 YKNVKPDYLKNIWKVMNWKYASEVYEKECPS 231 >gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] Length = 228 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKV+NWKYAS++Y+KECP Sbjct: 199 YKNVRPDYLKNIWKVMNWKYASEVYQKECP 228 >gb|AFD34190.1| Mn superoxide dismutase [Jatropha curcas] Length = 239 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNVRPDYLKNIWKVINWKYAS++Y ECPS Sbjct: 208 YKNVRPDYLKNIWKVINWKYASEVYANECPS 238 >ref|XP_004240868.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Solanum lycopersicum] Length = 228 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVINWKYA+D+Y+ ECP Sbjct: 199 YKNVRPDYLKNIWKVINWKYANDVYENECP 228 >ref|XP_007011340.1| Superoxide dismutase [Theobroma cacao] gi|508728253|gb|EOY20150.1| Superoxide dismutase [Theobroma cacao] Length = 230 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKVI+WKYAS++Y+KECP Sbjct: 201 YKNVRPDYLKNIWKVIDWKYASEVYEKECP 230 >gb|ABI35908.1| manganese superoxide dismutase [Rheum australe] Length = 233 Score = 65.9 bits (159), Expect = 6e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECPS 180 YKNV+PDYL NIWKV+NWKYAS+LY+KECP+ Sbjct: 200 YKNVKPDYLNNIWKVVNWKYASELYEKECPT 230 >sp|P11796.1|SODM_NICPL RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|19693|emb|CAA32643.1| unnamed protein product [Nicotiana plumbaginifolia] Length = 228 Score = 65.5 bits (158), Expect = 8e-09 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -1 Query: 272 YKNVRPDYLKNIWKVINWKYASDLYKKECP 183 YKNVRPDYLKNIWKV+NWKYA+++Y+KECP Sbjct: 199 YKNVRPDYLKNIWKVMNWKYANEVYEKECP 228