BLASTX nr result
ID: Cocculus23_contig00015386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00015386 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006844996.1| hypothetical protein AMTR_s00058p00197140 [A... 56 5e-06 >ref|XP_006844996.1| hypothetical protein AMTR_s00058p00197140 [Amborella trichopoda] gi|548847487|gb|ERN06671.1| hypothetical protein AMTR_s00058p00197140 [Amborella trichopoda] Length = 429 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 90 LVPLTIFDKAAFDLHVAVLYAFRPPMPSNE 1 L+PLTIFD+AAFDLHV V+YAFR PMPSN+ Sbjct: 21 LIPLTIFDRAAFDLHVPVIYAFRAPMPSND 50