BLASTX nr result
ID: Cocculus23_contig00015302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00015302 (230 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237852.1| uncharacterized protein LOC100499656 [Glycin... 58 2e-06 ref|NP_001241947.1| uncharacterized protein LOC100786192 [Glycin... 56 5e-06 ref|XP_002532240.1| 30S ribosomal protein S20, putative [Ricinus... 56 5e-06 ref|XP_006348272.1| PREDICTED: 30S ribosomal protein S20, chloro... 55 8e-06 ref|XP_007021565.1| 30S ribosomal protein S20 isoform 3 [Theobro... 55 8e-06 ref|XP_007021563.1| 30S ribosomal protein S20 isoform 1 [Theobro... 55 8e-06 ref|XP_002285149.1| PREDICTED: 30S ribosomal protein S20, chloro... 55 8e-06 >ref|NP_001237852.1| uncharacterized protein LOC100499656 [Glycine max] gi|255625577|gb|ACU13133.1| unknown [Glycine max] Length = 180 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPA 152 TGANRKSRLARRKK+VEIHHGWYTPA Sbjct: 150 TGANRKSRLARRKKAVEIHHGWYTPA 175 >ref|NP_001241947.1| uncharacterized protein LOC100786192 [Glycine max] gi|255640470|gb|ACU20521.1| unknown [Glycine max] Length = 164 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTP 155 TGANRKSRLARRKK+VEIHHGWYTP Sbjct: 134 TGANRKSRLARRKKAVEIHHGWYTP 158 >ref|XP_002532240.1| 30S ribosomal protein S20, putative [Ricinus communis] gi|223528058|gb|EEF30134.1| 30S ribosomal protein S20, putative [Ricinus communis] Length = 185 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPAAVTA 140 TGA RKSRLARRKK+VEIHHGWYTPA A Sbjct: 153 TGARRKSRLARRKKAVEIHHGWYTPAPAEA 182 >ref|XP_006348272.1| PREDICTED: 30S ribosomal protein S20, chloroplastic-like [Solanum tuberosum] Length = 184 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPAAVT 143 TGA RKSRLARRKK+VEIHHGWY P A T Sbjct: 148 TGARRKSRLARRKKAVEIHHGWYVPVAAT 176 >ref|XP_007021565.1| 30S ribosomal protein S20 isoform 3 [Theobroma cacao] gi|508721193|gb|EOY13090.1| 30S ribosomal protein S20 isoform 3 [Theobroma cacao] Length = 186 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPA 152 TGA RKSRLARRKK+VEIHHGWYTPA Sbjct: 155 TGARRKSRLARRKKAVEIHHGWYTPA 180 >ref|XP_007021563.1| 30S ribosomal protein S20 isoform 1 [Theobroma cacao] gi|508721191|gb|EOY13088.1| 30S ribosomal protein S20 isoform 1 [Theobroma cacao] Length = 193 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPA 152 TGA RKSRLARRKK+VEIHHGWYTPA Sbjct: 162 TGARRKSRLARRKKAVEIHHGWYTPA 187 >ref|XP_002285149.1| PREDICTED: 30S ribosomal protein S20, chloroplastic [Vitis vinifera] gi|302142967|emb|CBI20262.3| unnamed protein product [Vitis vinifera] Length = 183 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 229 TGANRKSRLARRKKSVEIHHGWYTPA 152 TGA RKSRLARRKK+VEIHHGWYTPA Sbjct: 153 TGARRKSRLARRKKAVEIHHGWYTPA 178