BLASTX nr result
ID: Cocculus23_contig00015187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00015187 (672 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035425.1| Squamosa promoter binding protein-like 7, pu... 61 4e-07 ref|XP_007225666.1| hypothetical protein PRUPE_ppa001613mg [Prun... 57 5e-06 >ref|XP_007035425.1| Squamosa promoter binding protein-like 7, putative [Theobroma cacao] gi|508714454|gb|EOY06351.1| Squamosa promoter binding protein-like 7, putative [Theobroma cacao] Length = 807 Score = 60.8 bits (146), Expect = 4e-07 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -2 Query: 665 KSRPLTLMVAATVVCVGMCVVLFHPHRVREFAVSVRRCLF 546 +SRP L++A +C+GMC VLFHP++V EFAV++RRCLF Sbjct: 761 RSRPAVLILATAAICLGMCAVLFHPNKVGEFAVTIRRCLF 800 >ref|XP_007225666.1| hypothetical protein PRUPE_ppa001613mg [Prunus persica] gi|462422602|gb|EMJ26865.1| hypothetical protein PRUPE_ppa001613mg [Prunus persica] Length = 792 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/38 (57%), Positives = 29/38 (76%) Frame = -2 Query: 659 RPLTLMVAATVVCVGMCVVLFHPHRVREFAVSVRRCLF 546 RP ++ A +C+G C VLFHPH+V EFAV++RRCLF Sbjct: 752 RPALYVICAAAICLGFCAVLFHPHKVGEFAVTMRRCLF 789