BLASTX nr result
ID: Cocculus23_contig00015021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00015021 (1215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007218697.1| hypothetical protein PRUPE_ppa008785mg [Prun... 60 2e-06 ref|XP_006362665.1| PREDICTED: glutaminyl-peptide cyclotransfera... 58 9e-06 >ref|XP_007218697.1| hypothetical protein PRUPE_ppa008785mg [Prunus persica] gi|462415159|gb|EMJ19896.1| hypothetical protein PRUPE_ppa008785mg [Prunus persica] Length = 319 Score = 60.1 bits (144), Expect = 2e-06 Identities = 31/44 (70%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = -3 Query: 424 DTSHLFTVTGKLWPKLYEIKLHPTKGPF-VGSIERLCLRRPFDF 296 D +F VTGKLWPKLYEIKLHP K F G+IE LCLRRPF F Sbjct: 277 DKKRIF-VTGKLWPKLYEIKLHPIKKHFRDGAIEELCLRRPFHF 319 >ref|XP_006362665.1| PREDICTED: glutaminyl-peptide cyclotransferase-like [Solanum tuberosum] Length = 328 Score = 57.8 bits (138), Expect = 9e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -3 Query: 424 DTSHLFTVTGKLWPKLYEIKLHPTKGPFVGSIERLCLRRPFDFT 293 D LF VTGKLWPKLYEIKLHP K PF G I+++C+ F F+ Sbjct: 286 DGDRLF-VTGKLWPKLYEIKLHPLKTPFNGDIKQMCMPPAFSFS 328