BLASTX nr result
ID: Cocculus23_contig00014168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00014168 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC93602.1| hypothetical protein BAUCODRAFT_37282 [Baudoinia ... 62 6e-08 >gb|EMC93602.1| hypothetical protein BAUCODRAFT_37282 [Baudoinia compniacensis UAMH 10762] Length = 78 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 198 MKFFTSIL-ALASAALVYADQPNPFTSTTAQLQTSAGSTVNITWTPTTQGTVSLLLRYGN 22 MKF S+L AL+SAA + + Q NPF +AG +N+TWTPTTQGTV+L+LR G+ Sbjct: 1 MKFVHSLLLALSSAASLVSAQSNPFKVPPGNYVATAGQPLNLTWTPTTQGTVTLVLRSGS 60 Query: 21 SAFL 10 SA L Sbjct: 61 SANL 64