BLASTX nr result
ID: Cocculus23_contig00012029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00012029 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007017026.1| Uncharacterized protein TCM_042248 [Theobrom... 62 8e-08 ref|XP_003615963.1| hypothetical protein MTR_5g074550 [Medicago ... 57 4e-06 gb|EXB56622.1| hypothetical protein L484_003310 [Morus notabilis] 56 6e-06 ref|XP_002325662.2| hypothetical protein POPTR_0019s14690g [Popu... 55 8e-06 >ref|XP_007017026.1| Uncharacterized protein TCM_042248 [Theobroma cacao] gi|508787389|gb|EOY34645.1| Uncharacterized protein TCM_042248 [Theobroma cacao] Length = 277 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = +3 Query: 66 PVITQIPVDLFVSRKRLGLTRGVLTFSDACDNLVFSVDDRSSNTAARTTRILLDRRGVPL 245 P + IP+DLFVS+K+ GL RGVL F+D+ +VF ++ +SS ++A +LLD G PL Sbjct: 29 PANSPIPIDLFVSKKQPGLPRGVLGFADSSGKIVFRINRQSSQSSADDRTVLLDSAGNPL 88 Query: 246 ISI 254 ISI Sbjct: 89 ISI 91 >ref|XP_003615963.1| hypothetical protein MTR_5g074550 [Medicago truncatula] gi|355517298|gb|AES98921.1| hypothetical protein MTR_5g074550 [Medicago truncatula] Length = 196 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 4/64 (6%) Frame = +3 Query: 81 IPVDLFVSRKRLGLTRGVLTFSDACDNLVFSV----DDRSSNTAARTTRILLDRRGVPLI 248 IP+DLF S+K G+ RG+L F+DA N+VF V D +S+++ + T++LLD PL Sbjct: 16 IPIDLFGSKKHAGVPRGILAFTDASGNIVFKVHRQPPDPNSSSSLKDTKLLLDSNDNPLF 75 Query: 249 SISR 260 SI R Sbjct: 76 SIHR 79 >gb|EXB56622.1| hypothetical protein L484_003310 [Morus notabilis] Length = 595 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/75 (38%), Positives = 46/75 (61%), Gaps = 2/75 (2%) Frame = +3 Query: 36 RKPKDHHMTEPVITQIPVDLFVSRKRLGLTRGVLTFSDACDNLVFSVDDRSS--NTAART 209 RK ++P+ IPVDLFVS+K GVL F D+ +N+++ ++ RSS ++++ Sbjct: 406 RKETGFSESDPIPIPIPVDLFVSKKHPAYKHGVLCFVDSFNNIIYKINRRSSLQSSSSSN 465 Query: 210 TRILLDRRGVPLISI 254 R+L D G PL+SI Sbjct: 466 KRVLFDAAGNPLLSI 480 >ref|XP_002325662.2| hypothetical protein POPTR_0019s14690g [Populus trichocarpa] gi|550317574|gb|EEF00044.2| hypothetical protein POPTR_0019s14690g [Populus trichocarpa] Length = 186 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +3 Query: 66 PVITQIPVDLFVSRKRLGLTRGVLTFSDACDNLVFSVD-DRSSNTAARTTRILLDRRGVP 242 P + IPVDLFVS+K GL G L F+D+ N+VF V+ D+SS ++ + R+LLD G P Sbjct: 9 PAVVPIPVDLFVSKKHPGL-NGDLGFADSLGNIVFKVNFDKSSKSSFK--RVLLDASGNP 65 Query: 243 LISISRD 263 LI++ RD Sbjct: 66 LITMFRD 72