BLASTX nr result
ID: Cocculus23_contig00010191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00010191 (344 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001268092.1| 3-dehydroquinate synthase-like [Vitis vinife... 56 6e-06 emb|CBI17335.3| unnamed protein product [Vitis vinifera] 56 6e-06 >ref|NP_001268092.1| 3-dehydroquinate synthase-like [Vitis vinifera] gi|222136863|gb|ACM45081.1| 3-dehydroquinate synthase [Vitis vinifera] Length = 456 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 226 RIRSKISASSAQVMDQKESNTGSRVPTVVDVDLGTRSYP 342 RI S+ISASS VMDQ S T RVPTVV+VDLG RSYP Sbjct: 67 RIGSRISASSTPVMDQSPSQTSPRVPTVVEVDLGNRSYP 105 >emb|CBI17335.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = +1 Query: 226 RIRSKISASSAQVMDQKESNTGSRVPTVVDVDLGTRSYP 342 RI S+ISASS VMDQ S T RVPTVV+VDLG RSYP Sbjct: 67 RIGSRISASSTPVMDQSPSQTSPRVPTVVEVDLGNRSYP 105