BLASTX nr result
ID: Cocculus23_contig00009972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00009972 (622 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME49394.1| hypothetical protein DOTSEDRAFT_19851 [Dothistrom... 61 3e-07 >gb|EME49394.1| hypothetical protein DOTSEDRAFT_19851 [Dothistroma septosporum NZE10] Length = 63 Score = 60.8 bits (146), Expect = 3e-07 Identities = 34/63 (53%), Positives = 34/63 (53%) Frame = -1 Query: 457 MGAVASCFNSVVNAITSCFMXXXXXXXXXXXXXXXXXXXXVMAIVSCLTCGKAGRRRGTT 278 MGAV SCF SVVNAITSCFM AI S LTCGK RRR TT Sbjct: 1 MGAVVSCFESVVNAITSCFMAVVNAIVAVIKAIINGIVAIFYAIASVLTCGKVKRRRATT 60 Query: 277 SAV 269 SAV Sbjct: 61 SAV 63