BLASTX nr result
ID: Cocculus23_contig00009868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00009868 (1720 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containi... 105 5e-20 ref|XP_006451455.1| hypothetical protein CICLE_v10010770mg, part... 104 6e-20 ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containi... 105 6e-20 ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citr... 105 6e-20 ref|XP_007202010.1| hypothetical protein PRUPE_ppa005177mg [Prun... 103 2e-19 ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communi... 102 7e-19 ref|XP_002309975.2| transducin family protein [Populus trichocar... 101 1e-18 ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|XP_007139165.1| hypothetical protein PHAVU_008G006800g [Phas... 100 3e-18 ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containi... 100 3e-18 ref|NP_001275436.1| glutamate-rich WD repeat-containing protein ... 100 3e-18 gb|ACU20888.1| unknown [Glycine max] 100 3e-18 ref|XP_003612352.1| Glutamate-rich WD repeat-containing protein ... 99 6e-18 ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containi... 99 8e-18 ref|XP_002886033.1| transducin family protein [Arabidopsis lyrat... 98 1e-17 ref|NP_179544.1| transducin family protein / WD-40 repeat family... 98 1e-17 >ref|XP_002282252.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Vitis vinifera] gi|297738673|emb|CBI27918.3| unnamed protein product [Vitis vinifera] Length = 474 Score = 105 bits (263), Expect = 5e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFH+GWPCLSFDIV Sbjct: 27 VPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHVGWPCLSFDIV 73 >ref|XP_006451455.1| hypothetical protein CICLE_v10010770mg, partial [Citrus clementina] gi|557554681|gb|ESR64695.1| hypothetical protein CICLE_v10010770mg, partial [Citrus clementina] Length = 490 Score = 104 bits (259), Expect(2) = 6e-20 Identities = 45/47 (95%), Positives = 47/47 (100%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPSLPTKVWQPGVDKLEEGEELQCDP+AYNSLHAFHIGWPCLSFDI+ Sbjct: 44 IPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDIL 90 Score = 21.9 bits (45), Expect(2) = 6e-20 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 1487 WFEV*KTLKRQNERTRALRR 1546 WF +T +R ERTR ++ Sbjct: 16 WFAASRTQRRPKERTRTQKK 35 >ref|XP_006493908.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Citrus sinensis] gi|568882164|ref|XP_006493909.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Citrus sinensis] gi|568882166|ref|XP_006493910.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X3 [Citrus sinensis] gi|568882168|ref|XP_006493911.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X4 [Citrus sinensis] gi|568882170|ref|XP_006493912.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X5 [Citrus sinensis] Length = 475 Score = 105 bits (262), Expect = 6e-20 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPSLPTKVWQPGVDKLEEGEELQCDP+AYNSLHAFHIGWPCLSFDIV Sbjct: 29 IPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDIV 75 >ref|XP_006421443.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|567857522|ref|XP_006421444.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523316|gb|ESR34683.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] gi|557523317|gb|ESR34684.1| hypothetical protein CICLE_v10004888mg [Citrus clementina] Length = 475 Score = 105 bits (262), Expect = 6e-20 Identities = 46/47 (97%), Positives = 47/47 (100%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPSLPTKVWQPGVDKLEEGEELQCDP+AYNSLHAFHIGWPCLSFDIV Sbjct: 29 IPSLPTKVWQPGVDKLEEGEELQCDPTAYNSLHAFHIGWPCLSFDIV 75 >ref|XP_007202010.1| hypothetical protein PRUPE_ppa005177mg [Prunus persica] gi|462397541|gb|EMJ03209.1| hypothetical protein PRUPE_ppa005177mg [Prunus persica] Length = 473 Score = 103 bits (258), Expect = 2e-19 Identities = 45/47 (95%), Positives = 46/47 (97%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPS+P KVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV Sbjct: 29 IPSMPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 75 >ref|XP_002527727.1| WD-repeat protein, putative [Ricinus communis] gi|223532868|gb|EEF34640.1| WD-repeat protein, putative [Ricinus communis] Length = 476 Score = 102 bits (253), Expect = 7e-19 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IP++PTKVWQPGVDKLEEGEEL+CDPSAYNSLH FHIGWPCLSFDIV Sbjct: 28 IPTMPTKVWQPGVDKLEEGEELECDPSAYNSLHGFHIGWPCLSFDIV 74 >ref|XP_002309975.2| transducin family protein [Populus trichocarpa] gi|550334174|gb|EEE90425.2| transducin family protein [Populus trichocarpa] Length = 459 Score = 101 bits (251), Expect = 1e-18 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPS+PTKVWQPGVD LEEGEEL+CDP+AYNSLHAFHIGWPCLSFD+V Sbjct: 27 IPSMPTKVWQPGVDNLEEGEELECDPTAYNSLHAFHIGWPCLSFDVV 73 >ref|XP_006580121.1| PREDICTED: glutamate-rich WD repeat-containing protein 1 [Glycine max] Length = 473 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1582 PSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 P +P KVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDI+ Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIL 75 >ref|XP_006585120.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Glycine max] Length = 474 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1582 PSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 P +P KVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDI+ Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIL 75 >ref|XP_006346562.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 469 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLP KVWQPGVDKLEEGEELQCD SAYNSLHAFHIGWPCLSFD++ Sbjct: 27 VPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWPCLSFDVL 73 >ref|XP_006346561.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform X1 [Solanum tuberosum] Length = 470 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLP KVWQPGVDKLEEGEELQCD SAYNSLHAFHIGWPCLSFD++ Sbjct: 28 VPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWPCLSFDVL 74 >ref|XP_007139165.1| hypothetical protein PHAVU_008G006800g [Phaseolus vulgaris] gi|561012298|gb|ESW11159.1| hypothetical protein PHAVU_008G006800g [Phaseolus vulgaris] Length = 472 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1582 PSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 P +P KVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDI+ Sbjct: 28 PQIPVKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIL 73 >ref|XP_004243762.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 2 [Solanum lycopersicum] Length = 468 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLP KVWQPGVDKLEEGEELQCD SAYNSLHAFHIGWPCLSFD++ Sbjct: 27 VPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWPCLSFDVL 73 >ref|XP_004243761.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like isoform 1 [Solanum lycopersicum] Length = 475 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLP KVWQPGVDKLEEGEELQCD SAYNSLHAFHIGWPCLSFD++ Sbjct: 27 VPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWPCLSFDVL 73 >ref|NP_001275436.1| glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] gi|82400122|gb|ABB72800.1| WD-40 repeat protein-like protein [Solanum tuberosum] Length = 464 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSLP KVWQPGVDKLEEGEELQCD SAYNSLHAFHIGWPCLSFD++ Sbjct: 27 VPSLPAKVWQPGVDKLEEGEELQCDASAYNSLHAFHIGWPCLSFDVL 73 >gb|ACU20888.1| unknown [Glycine max] Length = 108 Score = 99.8 bits (247), Expect = 3e-18 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = +1 Query: 1582 PSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 P +P KVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDI+ Sbjct: 30 PEIPAKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIL 75 >ref|XP_003612352.1| Glutamate-rich WD repeat-containing protein [Medicago truncatula] gi|355513687|gb|AES95310.1| Glutamate-rich WD repeat-containing protein [Medicago truncatula] Length = 455 Score = 99.0 bits (245), Expect = 6e-18 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +P LP KVWQPGVD+LEE EELQCDPSAYNSLHAFHIGWPCLSFDIV Sbjct: 22 VPQLPVKVWQPGVDRLEEDEELQCDPSAYNSLHAFHIGWPCLSFDIV 68 >ref|XP_006350988.1| PREDICTED: glutamate-rich WD repeat-containing protein 1-like [Solanum tuberosum] Length = 463 Score = 98.6 bits (244), Expect = 8e-18 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 +PSL KVWQPGVD+LEEGEELQCDPSAYNSLHAFHIGWPC+SFD+V Sbjct: 25 VPSLAAKVWQPGVDELEEGEELQCDPSAYNSLHAFHIGWPCMSFDVV 71 >ref|XP_002886033.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297331873|gb|EFH62292.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 470 Score = 98.2 bits (243), Expect = 1e-17 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPS+PT+VWQPGVD LE+GEELQCDPSAYNSLH FH+GWPCLSFDI+ Sbjct: 24 IPSIPTRVWQPGVDTLEDGEELQCDPSAYNSLHGFHVGWPCLSFDIL 70 >ref|NP_179544.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] gi|13877611|gb|AAK43883.1|AF370506_1 putative WD-40 repeat protein [Arabidopsis thaliana] gi|4191784|gb|AAD10153.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|22136272|gb|AAM91214.1| putative WD-40 repeat protein [Arabidopsis thaliana] gi|330251799|gb|AEC06893.1| transducin family protein / WD-40 repeat family protein [Arabidopsis thaliana] Length = 469 Score = 98.2 bits (243), Expect = 1e-17 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = +1 Query: 1579 IPSLPTKVWQPGVDKLEEGEELQCDPSAYNSLHAFHIGWPCLSFDIV 1719 IPS+PT+VWQPGVD LE+GEELQCDPSAYNSLH FH+GWPCLSFDI+ Sbjct: 24 IPSIPTRVWQPGVDTLEDGEELQCDPSAYNSLHGFHVGWPCLSFDIL 70