BLASTX nr result
ID: Cocculus23_contig00009788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00009788 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB29125.1| hypothetical protein L484_019647 [Morus notabilis] 55 8e-06 gb|EMT12490.1| hypothetical protein F775_30019 [Aegilops tauschii] 55 8e-06 gb|EMS59528.1| hypothetical protein TRIUR3_08592 [Triticum urartu] 55 8e-06 >gb|EXB29125.1| hypothetical protein L484_019647 [Morus notabilis] Length = 364 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 250 DFLNDENDTENGETGMQDEWREGGEFDLNSR 158 DFLNDE +TENGETGMQD WRE GEFDLN+R Sbjct: 335 DFLNDE-ETENGETGMQDGWREVGEFDLNTR 364 >gb|EMT12490.1| hypothetical protein F775_30019 [Aegilops tauschii] Length = 336 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 250 DFLNDENDTENGETGMQDEWREGGEFDLNSR 158 DFLNDEN+ ENG + MQ+EWR GEFDLNSR Sbjct: 306 DFLNDENEPENGNSDMQEEWRRSGEFDLNSR 336 >gb|EMS59528.1| hypothetical protein TRIUR3_08592 [Triticum urartu] Length = 270 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 250 DFLNDENDTENGETGMQDEWREGGEFDLNSR 158 DFLNDEN+ ENG + MQ+EWR GEFDLNSR Sbjct: 240 DFLNDENEPENGNSDMQEEWRRSGEFDLNSR 270