BLASTX nr result
ID: Cocculus23_contig00009145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00009145 (536 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511901.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002511901.1| conserved hypothetical protein [Ricinus communis] gi|223549081|gb|EEF50570.1| conserved hypothetical protein [Ricinus communis] Length = 490 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 535 SKDELYSTEQDILLKAVDIIQKHGAALGSTLQDST 431 SKDELYSTEQDILL++V II++HGA+LGST QD T Sbjct: 454 SKDELYSTEQDILLQSVRIIKEHGASLGSTWQDVT 488