BLASTX nr result
ID: Cocculus23_contig00007929
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007929 (427 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON98711.1| hypothetical protein UCRPA7_5766 [Togninia minima... 65 7e-09 ref|XP_001911641.1| hypothetical protein [Podospora anserina S m... 57 3e-06 >gb|EON98711.1| hypothetical protein UCRPA7_5766 [Togninia minima UCRPA7] Length = 103 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = -1 Query: 427 DAATPLHIDPTNFKLYVRANCQGLSYSNGDGDFSLTPARVIRSYSV 290 D T LH DP F+LYV C+GLSY NG GDF+LTPAR IRSY V Sbjct: 57 DPKTSLHSDPGTFELYVNKGCEGLSYRNGKGDFTLTPARKIRSYKV 102 >ref|XP_001911641.1| hypothetical protein [Podospora anserina S mat+] gi|170946665|emb|CAP73468.1| unnamed protein product [Podospora anserina S mat+] Length = 104 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = -1 Query: 418 TPLHIDPTNFKLYVRANCQGLSYSNGDGDFSLTPARVIRSYSV 290 T L DP F+L+V NC GLSY NG+GD LTPAR IRSY V Sbjct: 60 TSLLPDPNTFELFVNKNCDGLSYRNGNGDHRLTPARKIRSYRV 102