BLASTX nr result
ID: Cocculus23_contig00007803
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007803 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034342.1| Auxin efflux carrier family protein isoform ... 80 2e-13 ref|XP_006848444.1| hypothetical protein AMTR_s00013p00242590 [A... 80 3e-13 ref|XP_002967582.1| hypothetical protein SELMODRAFT_88887 [Selag... 80 4e-13 ref|XP_002981763.1| hypothetical protein SELMODRAFT_451571 [Sela... 80 4e-13 gb|AAD52696.1|AF087819_1 auxin transport protein [Arabidopsis th... 79 5e-13 ref|NP_177836.1| auxin efflux carrier protein PIN6 [Arabidopsis ... 79 5e-13 ref|XP_002887669.1| auxin transport protein [Arabidopsis lyrata ... 79 5e-13 ref|XP_002320435.2| hypothetical protein POPTR_0014s14390g [Popu... 79 9e-13 ref|XP_007199276.1| hypothetical protein PRUPE_ppa022797mg [Prun... 79 9e-13 ref|XP_002278449.2| PREDICTED: probable auxin efflux carrier com... 79 9e-13 emb|CBI19962.3| unnamed protein product [Vitis vinifera] 79 9e-13 emb|CAN65343.1| hypothetical protein VITISV_025052 [Vitis vinifera] 79 9e-13 gb|AHN96184.1| PIN-formed protein 1 [Gossypium raimondii] 78 1e-12 gb|AHN96183.1| PIN-formed protein 1 [Gossypium arboreum] 78 1e-12 ref|NP_177500.1| auxin efflux carrier component 1 [Arabidopsis t... 78 1e-12 ref|XP_006356709.1| PREDICTED: probable auxin efflux carrier com... 78 1e-12 ref|XP_006300880.1| hypothetical protein CARUB_v10019970mg [Caps... 78 1e-12 gb|AAD04376.1| putative auxin efflux carrier protein [Arabidopsi... 78 1e-12 gb|AEK01107.1| auxin transport protein [Capsella bursa-pastoris] 78 1e-12 ref|NP_001234199.1| auxin efflux facilitator SlPIN6 [Solanum lyc... 78 1e-12 >ref|XP_007034342.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] gi|508713371|gb|EOY05268.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 454 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVF+REYNLHPDVLSTAVIFGMIVSLP+T+LYYILLG+ Sbjct: 414 IVPFVFSREYNLHPDVLSTAVIFGMIVSLPITILYYILLGI 454 >ref|XP_006848444.1| hypothetical protein AMTR_s00013p00242590 [Amborella trichopoda] gi|548851750|gb|ERN10025.1| hypothetical protein AMTR_s00013p00242590 [Amborella trichopoda] Length = 419 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREYNLHPDVLSTAVIFGMIVSLP+T+LYY+ LGL Sbjct: 379 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPITVLYYVFLGL 419 >ref|XP_002967582.1| hypothetical protein SELMODRAFT_88887 [Selaginella moellendorffii] gi|300164320|gb|EFJ30929.1| hypothetical protein SELMODRAFT_88887 [Selaginella moellendorffii] Length = 636 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPDVLSTAVIFGM+VSLP+TLLYY+LLGL Sbjct: 596 IVPFVFAKEYNVHPDVLSTAVIFGMLVSLPITLLYYVLLGL 636 >ref|XP_002981763.1| hypothetical protein SELMODRAFT_451571 [Selaginella moellendorffii] gi|300150595|gb|EFJ17245.1| hypothetical protein SELMODRAFT_451571 [Selaginella moellendorffii] Length = 625 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPDVLSTAVIFGM+VSLP+TLLYY+LLGL Sbjct: 585 IVPFVFAKEYNVHPDVLSTAVIFGMLVSLPITLLYYVLLGL 625 >gb|AAD52696.1|AF087819_1 auxin transport protein [Arabidopsis thaliana] Length = 570 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREYNLHPD+LST VIFGMIVSLPVT+LYY+LLGL Sbjct: 530 IVPFVFAREYNLHPDLLSTLVIFGMIVSLPVTILYYVLLGL 570 >ref|NP_177836.1| auxin efflux carrier protein PIN6 [Arabidopsis thaliana] gi|42558888|sp|Q9SQH6.2|PIN6_ARATH RecName: Full=Probable auxin efflux carrier component 6; Short=AtPIN6 gi|332197815|gb|AEE35936.1| auxin efflux carrier protein PIN6 [Arabidopsis thaliana] Length = 570 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREYNLHPD+LST VIFGMIVSLPVT+LYY+LLGL Sbjct: 530 IVPFVFAREYNLHPDLLSTLVIFGMIVSLPVTILYYVLLGL 570 >ref|XP_002887669.1| auxin transport protein [Arabidopsis lyrata subsp. lyrata] gi|297333510|gb|EFH63928.1| auxin transport protein [Arabidopsis lyrata subsp. lyrata] Length = 551 Score = 79.3 bits (194), Expect = 5e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREYNLHPD+LST VIFGMIVSLPVT+LYY+LLGL Sbjct: 511 IVPFVFAREYNLHPDLLSTLVIFGMIVSLPVTILYYVLLGL 551 >ref|XP_002320435.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa] gi|550324188|gb|EEE98750.2| hypothetical protein POPTR_0014s14390g [Populus trichocarpa] Length = 370 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPDVLSTAVIFGMIVSLP+T+LYYI LGL Sbjct: 330 IVPFVFAREYGLHPDVLSTAVIFGMIVSLPITILYYIFLGL 370 >ref|XP_007199276.1| hypothetical protein PRUPE_ppa022797mg [Prunus persica] gi|462394676|gb|EMJ00475.1| hypothetical protein PRUPE_ppa022797mg [Prunus persica] Length = 550 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYYILLGL Sbjct: 509 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYILLGL 549 >ref|XP_002278449.2| PREDICTED: probable auxin efflux carrier component 6-like [Vitis vinifera] Length = 532 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYYILLGL Sbjct: 492 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYILLGL 532 >emb|CBI19962.3| unnamed protein product [Vitis vinifera] Length = 527 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYYILLGL Sbjct: 487 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYILLGL 527 >emb|CAN65343.1| hypothetical protein VITISV_025052 [Vitis vinifera] Length = 512 Score = 78.6 bits (192), Expect = 9e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYYILLGL Sbjct: 472 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYILLGL 512 >gb|AHN96184.1| PIN-formed protein 1 [Gossypium raimondii] Length = 605 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYNLHPD+LSTAVIFGM+++LP+TL+YYILLGL Sbjct: 565 IVPFVFAKEYNLHPDILSTAVIFGMLIALPITLVYYILLGL 605 >gb|AHN96183.1| PIN-formed protein 1 [Gossypium arboreum] Length = 605 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYNLHPD+LSTAVIFGM+++LP+TL+YYILLGL Sbjct: 565 IVPFVFAKEYNLHPDILSTAVIFGMLIALPITLVYYILLGL 605 >ref|NP_177500.1| auxin efflux carrier component 1 [Arabidopsis thaliana] gi|42558879|sp|Q9C6B8.1|PINI_ARATH RecName: Full=Auxin efflux carrier component 1; AltName: Full=Protein PIN-FORMED; Short=AtPIN1 gi|12323693|gb|AAG51807.1|AC079676_2 auxin transporter splice variant b, putative; 17621-14517 [Arabidopsis thaliana] gi|13937193|gb|AAK50090.1|AF372950_1 At1g73590/F6D5_2 [Arabidopsis thaliana] gi|20334720|gb|AAM16221.1| At1g73590/F6D5_2 [Arabidopsis thaliana] gi|332197358|gb|AEE35479.1| auxin efflux carrier component 1 [Arabidopsis thaliana] Length = 622 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPD+LSTAVIFGM+++LP+TLLYYILLGL Sbjct: 582 IVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYYILLGL 622 >ref|XP_006356709.1| PREDICTED: probable auxin efflux carrier component 6-like [Solanum tuberosum] Length = 541 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYY+LLGL Sbjct: 501 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYVLLGL 541 >ref|XP_006300880.1| hypothetical protein CARUB_v10019970mg [Capsella rubella] gi|482569590|gb|EOA33778.1| hypothetical protein CARUB_v10019970mg [Capsella rubella] Length = 625 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPD+LSTAVIFGM+++LP+TLLYYILLGL Sbjct: 585 IVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYYILLGL 625 >gb|AAD04376.1| putative auxin efflux carrier protein [Arabidopsis thaliana] Length = 622 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPD+LSTAVIFGM+++LP+TLLYYILLGL Sbjct: 582 IVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYYILLGL 622 >gb|AEK01107.1| auxin transport protein [Capsella bursa-pastoris] Length = 622 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/41 (82%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFA+EYN+HPD+LSTAVIFGM+++LP+TLLYYILLGL Sbjct: 582 IVPFVFAKEYNVHPDILSTAVIFGMLIALPITLLYYILLGL 622 >ref|NP_001234199.1| auxin efflux facilitator SlPIN6 [Solanum lycopersicum] gi|327187149|gb|ADR30414.2| auxin efflux facilitator SlPIN6 [Solanum lycopersicum] Length = 538 Score = 78.2 bits (191), Expect = 1e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVPFVFAREYNLHPDVLSTAVIFGMIVSLPVTLLYYILLGL 123 IVPFVFAREY LHPD+LST VIFGM+VSLPVTLLYY+LLGL Sbjct: 498 IVPFVFAREYGLHPDILSTGVIFGMLVSLPVTLLYYVLLGL 538