BLASTX nr result
ID: Cocculus23_contig00007739
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007739 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004512980.1| PREDICTED: protein CbxX, chromosomal-like [C... 64 2e-08 ref|XP_003534199.1| PREDICTED: caseinolytic peptidase B protein ... 64 2e-08 ref|XP_007152834.1| hypothetical protein PHAVU_004G163800g [Phas... 64 3e-08 ref|XP_003528921.1| PREDICTED: caseinolytic peptidase B protein ... 64 3e-08 ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein ... 64 3e-08 ref|XP_007202023.1| hypothetical protein PRUPE_ppa005048mg [Prun... 62 1e-07 ref|XP_003620671.1| Ankyrin repeat domain-containing protein [Me... 61 1e-07 ref|XP_006451158.1| hypothetical protein CICLE_v10008142mg [Citr... 61 2e-07 ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus... 59 5e-07 ref|XP_004287411.1| PREDICTED: protein CbxX, chromosomal-like [F... 58 2e-06 ref|XP_007013171.1| AAA-type ATPase family protein / ankyrin rep... 56 6e-06 gb|EYU29798.1| hypothetical protein MIMGU_mgv1a005529mg [Mimulus... 55 8e-06 >ref|XP_004512980.1| PREDICTED: protein CbxX, chromosomal-like [Cicer arietinum] Length = 501 Score = 64.3 bits (155), Expect = 2e-08 Identities = 37/59 (62%), Positives = 40/59 (67%) Frame = -2 Query: 178 VGI*RGEREAMPGPFDQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 V + R + M DQRSR AK ATIHGCA SGDL GLQK L DNPSLLN+ N VMA Sbjct: 13 VDLRRNRKMLMNRSQDQRSRPAK-PATIHGCALSGDLIGLQKLLRDNPSLLNDTNPVMA 70 >ref|XP_003534199.1| PREDICTED: caseinolytic peptidase B protein homolog [Glycine max] Length = 484 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSR AK ATIHGCA SGDL GLQ+ L DNPSLLNE N VMA Sbjct: 11 DQRSRPAKA-ATIHGCALSGDLVGLQRLLRDNPSLLNERNPVMA 53 >ref|XP_007152834.1| hypothetical protein PHAVU_004G163800g [Phaseolus vulgaris] gi|561026143|gb|ESW24828.1| hypothetical protein PHAVU_004G163800g [Phaseolus vulgaris] Length = 483 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSR AK ATIHGCA SGDL GLQ+ L DNPSLLNE N VMA Sbjct: 10 DQRSRPAK-PATIHGCALSGDLAGLQRLLRDNPSLLNERNPVMA 52 >ref|XP_003528921.1| PREDICTED: caseinolytic peptidase B protein homolog isoform X1 [Glycine max] Length = 480 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSR AK ATIHGCA SGDL GLQ+ L DNPSLLNE N VMA Sbjct: 7 DQRSRPAK-PATIHGCALSGDLVGLQRLLRDNPSLLNERNPVMA 49 >ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein homolog [Vitis vinifera] gi|297738825|emb|CBI28070.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = -2 Query: 148 MPGPFDQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 M P DQRSRS+K TIHGCAQSGDL LQK L NPSLLN+ N VMA Sbjct: 1 MQRPLDQRSRSSK-PTTIHGCAQSGDLLALQKLLRGNPSLLNDRNPVMA 48 >ref|XP_007202023.1| hypothetical protein PRUPE_ppa005048mg [Prunus persica] gi|462397554|gb|EMJ03222.1| hypothetical protein PRUPE_ppa005048mg [Prunus persica] Length = 479 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSRSAK TIHG AQSGDL G QK L +NPSLLNE NA+MA Sbjct: 6 DQRSRSAK-PVTIHGYAQSGDLLGFQKLLRENPSLLNERNAIMA 48 >ref|XP_003620671.1| Ankyrin repeat domain-containing protein [Medicago truncatula] gi|355495686|gb|AES76889.1| Ankyrin repeat domain-containing protein [Medicago truncatula] Length = 479 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSR AK ATIH CA SGDL GLQK L DNPSLLN+ N VMA Sbjct: 6 DQRSRPAK-PATIHSCALSGDLIGLQKLLRDNPSLLNDKNPVMA 48 >ref|XP_006451158.1| hypothetical protein CICLE_v10008142mg [Citrus clementina] gi|568843458|ref|XP_006475624.1| PREDICTED: caseinolytic peptidase B protein homolog [Citrus sinensis] gi|557554384|gb|ESR64398.1| hypothetical protein CICLE_v10008142mg [Citrus clementina] Length = 482 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 D+RSRSAK ATIHGCAQSGDL Q+ L +NPSLLNE N VMA Sbjct: 6 DRRSRSAK-PATIHGCAQSGDLLAFQRLLRENPSLLNERNPVMA 48 >ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus communis] gi|223546755|gb|EEF48253.1| Protein cbxX, chromosomal, putative [Ricinus communis] Length = 481 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -2 Query: 136 FDQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 +DQRSRS+K TIHG AQSGDL QK L NPSLLNE N VMA Sbjct: 6 YDQRSRSSKQVTTIHGFAQSGDLLAFQKLLRVNPSLLNERNPVMA 50 >ref|XP_004287411.1| PREDICTED: protein CbxX, chromosomal-like [Fragaria vesca subsp. vesca] Length = 479 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVM 5 DQRSRSAK TIHG A SGDL+G QK L +NP+LLNE NA+M Sbjct: 6 DQRSRSAK-PTTIHGYAHSGDLSGFQKLLRENPALLNERNAIM 47 >ref|XP_007013171.1| AAA-type ATPase family protein / ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508783534|gb|EOY30790.1| AAA-type ATPase family protein / ankyrin repeat family protein isoform 1 [Theobroma cacao] Length = 479 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/44 (72%), Positives = 32/44 (72%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQRSRSAK TIH AQSGDL GLQK L D P LLNE N VMA Sbjct: 6 DQRSRSAK-PTTIHRFAQSGDLVGLQKLLKDKPFLLNERNPVMA 48 >gb|EYU29798.1| hypothetical protein MIMGU_mgv1a005529mg [Mimulus guttatus] Length = 480 Score = 55.5 bits (132), Expect = 8e-06 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -2 Query: 133 DQRSRSAKGQATIHGCAQSGDLTGLQKKLLDNPSLLNEPNAVMA 2 DQR RS+K TIHG AQSGDL QK L DNPSLLN+ N VMA Sbjct: 6 DQRPRSSK-PTTIHGFAQSGDLNSFQKLLRDNPSLLNDRNPVMA 48