BLASTX nr result
ID: Cocculus23_contig00007703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007703 (393 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|A7R385.1|CSPLC_VITVI RecName: Full=CASP-like protein GSVIVT00... 60 2e-07 ref|XP_002307903.1| integral membrane family protein [Populus tr... 60 3e-07 ref|XP_002522908.1| conserved hypothetical protein [Ricinus comm... 59 7e-07 gb|EYU27670.1| hypothetical protein MIMGU_mgv1a013955mg [Mimulus... 59 9e-07 ref|XP_007026315.1| CASP-like protein POPTRDRAFT_818956 isoform ... 58 1e-06 ref|XP_007026314.1| CASP-like protein POPTRDRAFT_818956 isoform ... 58 1e-06 ref|XP_007212067.1| hypothetical protein PRUPE_ppa011591mg [Prun... 58 1e-06 ref|XP_002323133.1| hypothetical protein POPTR_0016s01010g [Popu... 58 2e-06 ref|XP_004250287.1| PREDICTED: CASP-like protein GSVIVT000135020... 56 6e-06 ref|XP_006352330.1| PREDICTED: CASP-like protein RCOM_0864260-li... 55 8e-06 >sp|A7R385.1|CSPLC_VITVI RecName: Full=CASP-like protein GSVIVT00013502001 Length = 202 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYHG NLKVVD RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHGTNLKVVDRRVRLAELVLRCVIC 40 >ref|XP_002307903.1| integral membrane family protein [Populus trichocarpa] gi|341958562|sp|B9HD38.1|CSPLE_POPTR RecName: Full=CASP-like protein POPTRDRAFT_818956 gi|222853879|gb|EEE91426.1| integral membrane family protein [Populus trichocarpa] Length = 202 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYHG NLKV+D RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHGMNLKVIDRRVRLAELVLRCVIC 40 >ref|XP_002522908.1| conserved hypothetical protein [Ricinus communis] gi|288558967|sp|B9SA89.1|CSPLB_RICCO RecName: Full=CASP-like protein RCOM_0864260 gi|223537893|gb|EEF39508.1| conserved hypothetical protein [Ricinus communis] Length = 202 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYHG NLKV+D RVR+AE+VLRC+IC Sbjct: 10 PGNVPVYHGSNLKVIDKRVRLAELVLRCLIC 40 >gb|EYU27670.1| hypothetical protein MIMGU_mgv1a013955mg [Mimulus guttatus] gi|604314965|gb|EYU27671.1| hypothetical protein MIMGU_mgv1a013955mg [Mimulus guttatus] gi|604314966|gb|EYU27672.1| hypothetical protein MIMGU_mgv1a013955mg [Mimulus guttatus] gi|604314967|gb|EYU27673.1| hypothetical protein MIMGU_mgv1a013955mg [Mimulus guttatus] Length = 205 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYHG NLKV+D RVR+AE++LRCVIC Sbjct: 13 PGNVPVYHGSNLKVLDMRVRLAELILRCVIC 43 >ref|XP_007026315.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma cacao] gi|508781681|gb|EOY28937.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma cacao] Length = 209 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYH NLKV+D RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHATNLKVIDRRVRVAELVLRCVIC 40 >ref|XP_007026314.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao] gi|508781680|gb|EOY28936.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao] Length = 202 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYH NLKV+D RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHATNLKVIDRRVRVAELVLRCVIC 40 >ref|XP_007212067.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica] gi|462407932|gb|EMJ13266.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica] Length = 204 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYH NLKV+D RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHSTNLKVIDRRVRVAELVLRCVIC 40 >ref|XP_002323133.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa] gi|238055377|sp|B9IH36.1|CSPLJ_POPTR RecName: Full=CASP-like protein POPTRDRAFT_575900 gi|222867763|gb|EEF04894.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa] Length = 202 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVIC 391 PGN+PVYHG N KV+D RVR+AE+VLRCVIC Sbjct: 10 PGNVPVYHGTNSKVIDRRVRLAELVLRCVIC 40 >ref|XP_004250287.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Solanum lycopersicum] Length = 201 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVI 388 PGN+PVYHG NLKV+D RVR+ E+VLRCVI Sbjct: 10 PGNVPVYHGNNLKVIDRRVRVTELVLRCVI 39 >ref|XP_006352330.1| PREDICTED: CASP-like protein RCOM_0864260-like [Solanum tuberosum] Length = 201 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +2 Query: 299 PGNIPVYHGRNLKVVDGRVRIAEVVLRCVI 388 PGN+PVYHG NLKV+D RVR+ E+VLRC+I Sbjct: 10 PGNVPVYHGNNLKVIDRRVRVTELVLRCII 39