BLASTX nr result
ID: Cocculus23_contig00007574
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007574 (510 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282181.1| PREDICTED: ethylene-responsive transcription... 63 5e-08 gb|EXC02051.1| Ethylene-responsive transcription factor 5 [Morus... 58 2e-06 gb|AES92926.1| transcription factor ERF1 [Panax quinquefolius] 56 5e-06 ref|XP_004307779.1| PREDICTED: ethylene-responsive transcription... 56 6e-06 sp|Q9LW48.1|ERF5_NICSY RecName: Full=Ethylene-responsive transcr... 55 8e-06 >ref|XP_002282181.1| PREDICTED: ethylene-responsive transcription factor 5 [Vitis vinifera] gi|297745019|emb|CBI38611.3| unnamed protein product [Vitis vinifera] Length = 242 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -1 Query: 393 SLPAVCPLTPSSWTAVWESVDGNGAFNVPPLSPL 292 S CPLTPSSWTAVW+ DGNG FNVPPLSPL Sbjct: 203 STAVACPLTPSSWTAVWDGADGNGIFNVPPLSPL 236 >gb|EXC02051.1| Ethylene-responsive transcription factor 5 [Morus notabilis] Length = 349 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 5/42 (11%) Frame = -1 Query: 375 PLTPSSWTAVWESVDGNGAFNVPPLSPL-----FGFQELVVM 265 PLTPS+WTAVW+S DG G FNVPPLSPL G+ +L+V+ Sbjct: 308 PLTPSNWTAVWDSSDGQGVFNVPPLSPLSPHPSMGYPQLMVV 349 >gb|AES92926.1| transcription factor ERF1 [Panax quinquefolius] Length = 310 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/36 (66%), Positives = 26/36 (72%) Frame = -1 Query: 381 VCPLTPSSWTAVWESVDGNGAFNVPPLSPLFGFQEL 274 VCPLTPSSWTAVWE D G F +PPLSPL + L Sbjct: 262 VCPLTPSSWTAVWEGGDEKGIFEIPPLSPLSPYPNL 297 >ref|XP_004307779.1| PREDICTED: ethylene-responsive transcription factor 5-like [Fragaria vesca subsp. vesca] Length = 290 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 33/42 (78%), Gaps = 5/42 (11%) Frame = -1 Query: 378 CPLTPSSWTAVWESVDGNGAFNVPPLSPL-----FGFQELVV 268 CPLTPS+WT++W+S D +G F+VPPLSPL FG+ +L++ Sbjct: 248 CPLTPSNWTSIWDSKDLDGIFSVPPLSPLSPHPCFGYNQLLI 289 >sp|Q9LW48.1|ERF5_NICSY RecName: Full=Ethylene-responsive transcription factor 5; AltName: Full=Ethylene-responsive element-binding factor 4; Short=EREBP-4; AltName: Full=Ethylene-responsive element-binding factor 5 homolog; AltName: Full=NsERF4 gi|8809575|dbj|BAA97124.1| ethylene-responsive element binding factor [Nicotiana sylvestris] Length = 282 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -1 Query: 375 PLTPSSWTAVWESVDGNGAFNVPPLSPLFGFQELVVM 265 PLTPSSW+A+W+S DG G F VPPLSP + +LV++ Sbjct: 246 PLTPSSWSAIWDSGDGKGIFEVPPLSPFGAYSQLVMI 282