BLASTX nr result
ID: Cocculus23_contig00007102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00007102 (555 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC22521.1| hypothetical protein L484_003071 [Morus notabilis] 73 4e-11 ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [... 72 7e-11 ref|XP_007051629.1| Arabinogalactan protein 20 [Theobroma cacao]... 72 1e-10 ref|XP_004306698.1| PREDICTED: arabinogalactan peptide 16-like [... 71 2e-10 ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis... 70 3e-10 ref|XP_002320846.1| arabinogalactan-protein [Populus trichocarpa... 70 4e-10 ref|XP_004248073.1| PREDICTED: arabinogalactan peptide 20-like [... 67 3e-09 ref|XP_007218654.1| hypothetical protein PRUPE_ppa014010mg [Prun... 66 7e-09 gb|AAM12785.1| unknown [Capsicum annuum] 66 7e-09 ref|XP_006358644.1| PREDICTED: arabinogalactan peptide 20-like [... 65 1e-08 ref|XP_006444888.1| hypothetical protein CICLE_v10023364mg [Citr... 65 1e-08 ref|XP_006397819.1| hypothetical protein EUTSA_v10001752mg, part... 65 1e-08 ref|XP_004969359.1| PREDICTED: arabinogalactan peptide 16-like [... 65 1e-08 ref|XP_006295364.1| hypothetical protein CARUB_v10024456mg [Caps... 65 1e-08 ref|NP_566070.3| arabinogalactan protein 16 [Arabidopsis thalian... 65 1e-08 ref|XP_002456076.1| hypothetical protein SORBIDRAFT_03g029960 [S... 65 1e-08 ref|NP_001148394.1| AGP16 precursor [Zea mays] gi|195618932|gb|A... 65 1e-08 ref|XP_006647136.1| PREDICTED: arabinogalactan peptide 16-like [... 64 2e-08 dbj|BAK07439.1| predicted protein [Hordeum vulgare subsp. vulgar... 64 2e-08 gb|EEC80698.1| hypothetical protein OsI_23127 [Oryza sativa Indi... 64 2e-08 >gb|EXC22521.1| hypothetical protein L484_003071 [Morus notabilis] Length = 76 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGTS+DQG+AYVLMLVALVLTYLIHPLDASSYNFF Sbjct: 41 SDGTSIDQGVAYVLMLVALVLTYLIHPLDASSYNFF 76 >ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] gi|449477891|ref|XP_004155154.1| PREDICTED: arabinogalactan peptide 20-like [Cucumis sativus] Length = 78 Score = 72.4 bits (176), Expect = 7e-11 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGTS+DQGIAYVLML+ALVLTYLIHPLDASSYNFF Sbjct: 41 SDGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFF 76 >ref|XP_007051629.1| Arabinogalactan protein 20 [Theobroma cacao] gi|508703890|gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao] Length = 75 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGTS+DQGIAYVLMLVALVLTYLIHPLDASSY+FF Sbjct: 40 SDGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_004306698.1| PREDICTED: arabinogalactan peptide 16-like [Fragaria vesca subsp. vesca] Length = 85 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDG S+DQGIAYVLMLVALVLTYLIHPLDASSYNFF Sbjct: 50 SDGISIDQGIAYVLMLVALVLTYLIHPLDASSYNFF 85 >ref|XP_002280494.1| PREDICTED: arabinogalactan peptide 20 [Vitis vinifera] gi|147812721|emb|CAN61749.1| hypothetical protein VITISV_014579 [Vitis vinifera] gi|297745395|emb|CBI40475.3| unnamed protein product [Vitis vinifera] Length = 75 Score = 70.5 bits (171), Expect = 3e-10 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGT++DQGIAYVLMLVALVLTYLIHPLDASSY+FF Sbjct: 40 SDGTAIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_002320846.1| arabinogalactan-protein [Populus trichocarpa] gi|118483747|gb|ABK93766.1| unknown [Populus trichocarpa] gi|222861619|gb|EEE99161.1| arabinogalactan-protein [Populus trichocarpa] Length = 76 Score = 70.1 bits (170), Expect = 4e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGTS+DQGIAY+LMLVALVLTYLIHPLDASSY FF Sbjct: 41 SDGTSIDQGIAYLLMLVALVLTYLIHPLDASSYTFF 76 >ref|XP_004248073.1| PREDICTED: arabinogalactan peptide 20-like [Solanum lycopersicum] Length = 72 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDGT++DQGIAYVLML+ALVLTYLIHP+DAS+Y FF Sbjct: 37 SDGTTIDQGIAYVLMLLALVLTYLIHPMDASAYTFF 72 >ref|XP_007218654.1| hypothetical protein PRUPE_ppa014010mg [Prunus persica] gi|462415116|gb|EMJ19853.1| hypothetical protein PRUPE_ppa014010mg [Prunus persica] Length = 91 Score = 65.9 bits (159), Expect = 7e-09 Identities = 34/37 (91%), Positives = 35/37 (94%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDA-SSYNFF 401 SDGTS+DQGIAYVLMLVALVLTYLIHPLDA SSY FF Sbjct: 55 SDGTSIDQGIAYVLMLVALVLTYLIHPLDASSSYAFF 91 >gb|AAM12785.1| unknown [Capsicum annuum] Length = 67 Score = 65.9 bits (159), Expect = 7e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNFF 401 SDG S+DQGIAYVLMLVALVLTYLIHP+DASSY F Sbjct: 32 SDGISIDQGIAYVLMLVALVLTYLIHPMDASSYKLF 67 >ref|XP_006358644.1| PREDICTED: arabinogalactan peptide 20-like [Solanum tuberosum] Length = 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSYNF 404 SDGT++DQGIAYVLML+ALVLTYLIHP+DAS+Y F Sbjct: 37 SDGTTIDQGIAYVLMLLALVLTYLIHPMDASAYTF 71 >ref|XP_006444888.1| hypothetical protein CICLE_v10023364mg [Citrus clementina] gi|568876328|ref|XP_006491233.1| PREDICTED: arabinogalactan peptide 20-like [Citrus sinensis] gi|557547150|gb|ESR58128.1| hypothetical protein CICLE_v10023364mg [Citrus clementina] Length = 78 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDA-SSYNFF 401 SDGTS+DQGIAY+LMLVAL+LTYLIHPLDA SSY+FF Sbjct: 42 SDGTSIDQGIAYLLMLVALLLTYLIHPLDASSSYSFF 78 >ref|XP_006397819.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum] gi|557098892|gb|ESQ39272.1| hypothetical protein EUTSA_v10001752mg, partial [Eutrema salsugineum] Length = 110 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDA-SSYNFF 401 SDGTS+DQGIAY+LM+VALVLTYLIHPLDA SSY+FF Sbjct: 74 SDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 110 >ref|XP_004969359.1| PREDICTED: arabinogalactan peptide 16-like [Setaria italica] Length = 70 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/37 (91%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS Y F Sbjct: 34 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 70 >ref|XP_006295364.1| hypothetical protein CARUB_v10024456mg [Capsella rubella] gi|482564072|gb|EOA28262.1| hypothetical protein CARUB_v10024456mg [Capsella rubella] Length = 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDA-SSYNFF 401 SDGTS+DQGIAY+LM+VALVLTYLIHPLDA SSY+FF Sbjct: 37 SDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 73 >ref|NP_566070.3| arabinogalactan protein 16 [Arabidopsis thaliana] gi|297828351|ref|XP_002882058.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. lyrata] gi|75100629|sp|O82337.1|AGP16_ARATH RecName: Full=Arabinogalactan peptide 16; Short=AG-peptide 16; Flags: Precursor gi|10880509|gb|AAG24284.1|AF195897_1 arabinogalactan protein [Arabidopsis thaliana] gi|15294170|gb|AAK95262.1|AF410276_1 At2g46330/F11C10.2 [Arabidopsis thaliana] gi|4559376|gb|AAD23036.1| expressed protein [Arabidopsis thaliana] gi|20197373|gb|AAM15047.1| expressed protein [Arabidopsis thaliana] gi|20453295|gb|AAM19886.1| At2g46330/F11C10.2 [Arabidopsis thaliana] gi|21553759|gb|AAM62852.1| unknown [Arabidopsis thaliana] gi|297327897|gb|EFH58317.1| hypothetical protein ARALYDRAFT_483786 [Arabidopsis lyrata subsp. lyrata] gi|330255586|gb|AEC10680.1| arabinogalactan protein 16 [Arabidopsis thaliana] Length = 73 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDA-SSYNFF 401 SDGTS+DQGIAY+LM+VALVLTYLIHPLDA SSY+FF Sbjct: 37 SDGTSIDQGIAYLLMVVALVLTYLIHPLDASSSYSFF 73 >ref|XP_002456076.1| hypothetical protein SORBIDRAFT_03g029960 [Sorghum bicolor] gi|241928051|gb|EES01196.1| hypothetical protein SORBIDRAFT_03g029960 [Sorghum bicolor] Length = 74 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/37 (91%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS Y F Sbjct: 38 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 74 >ref|NP_001148394.1| AGP16 precursor [Zea mays] gi|195618932|gb|ACG31296.1| AGP16 [Zea mays] Length = 71 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/37 (91%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS Y F Sbjct: 35 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASSAYKLF 71 >ref|XP_006647136.1| PREDICTED: arabinogalactan peptide 16-like [Oryza brachyantha] Length = 74 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/37 (89%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTSVDQGIAY+LMLVALVLTYLIHPLDASS Y F Sbjct: 38 SDGTSVDQGIAYILMLVALVLTYLIHPLDASSPYRLF 74 >dbj|BAK07439.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|474222308|gb|EMS59323.1| hypothetical protein TRIUR3_30249 [Triticum urartu] Length = 72 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/37 (89%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTS+DQGIAYVLMLVALVLTYLIHPLDASS Y F Sbjct: 36 SDGTSIDQGIAYVLMLVALVLTYLIHPLDASSPYRLF 72 >gb|EEC80698.1| hypothetical protein OsI_23127 [Oryza sativa Indica Group] Length = 77 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/37 (89%), Positives = 34/37 (91%), Gaps = 1/37 (2%) Frame = -3 Query: 508 SDGTSVDQGIAYVLMLVALVLTYLIHPLDASS-YNFF 401 SDGTS+DQGIAYVLMLVALVLTYLIHPLDASS Y F Sbjct: 41 SDGTSIDQGIAYVLMLVALVLTYLIHPLDASSPYKLF 77