BLASTX nr result
ID: Cocculus23_contig00005478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00005478 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530889.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002530889.1| conserved hypothetical protein [Ricinus communis] gi|223529542|gb|EEF31495.1| conserved hypothetical protein [Ricinus communis] Length = 1876 Score = 55.8 bits (133), Expect = 6e-06 Identities = 42/119 (35%), Positives = 62/119 (52%), Gaps = 6/119 (5%) Frame = -3 Query: 374 NQNQAISSMQANNSKSPPQMPQYGFPIPYRPTYDLSSPRRI-ADADSDGA-QFQFAPVTP 201 NQ SS + S QMPQYGFPIPY P YDL+SP I ADA S FQFAP+ Sbjct: 175 NQAHCSSSNVPSGHNSLFQMPQYGFPIPYNPNYDLNSPPSIEADAASTVTNSFQFAPII- 233 Query: 200 DHAKQVQGNQHSEEAKLDETPNWRGN----NLQNKIAPAGNNIFRTNGEPPQFQPVINS 36 + AK+++ ++ + L P +G+ + Q+ + N+ + FQ +++S Sbjct: 234 EQAKKLE----NQLSALVNFPQGKGSSEERDKQDNYVVSLGNVPNQHNPDKLFQNIVDS 288