BLASTX nr result
ID: Cocculus23_contig00002992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00002992 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23874.1| hypothetical protein MIMGU_mgv1a011852mg [Mimulus... 62 6e-08 gb|EXB88918.1| hypothetical protein L484_003614 [Morus notabilis] 62 6e-08 ref|XP_006352709.1| PREDICTED: protein YIF1B-like isoform X1 [So... 62 6e-08 ref|XP_006443001.1| hypothetical protein CICLE_v10021639mg [Citr... 62 6e-08 ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutr... 62 6e-08 ref|XP_006372856.1| hypothetical protein POPTR_0017s05720g [Popu... 62 6e-08 ref|XP_007033919.1| Integral membrane HRF1 family protein [Theob... 62 6e-08 ref|XP_006305529.1| hypothetical protein CARUB_v10010016mg [Caps... 62 6e-08 ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria ve... 62 6e-08 ref|XP_007215807.1| hypothetical protein PRUPE_ppa009973mg [Prun... 62 6e-08 ref|XP_004242384.1| PREDICTED: protein YIF1B-like isoform 1 [Sol... 62 6e-08 ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sat... 62 6e-08 ref|XP_002890912.1| integral membrane HRF1 family protein [Arabi... 62 6e-08 ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] g... 62 6e-08 ref|NP_564367.1| integral membrane HRF1-like protein [Arabidopsi... 62 6e-08 ref|XP_006350294.1| PREDICTED: protein YIF1B-like [Solanum tuber... 62 8e-08 ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutr... 62 8e-08 ref|XP_006291680.1| hypothetical protein CARUB_v10017840mg [Caps... 62 8e-08 ref|XP_004247110.1| PREDICTED: protein YIF1B-B-like [Solanum lyc... 62 8e-08 ref|NP_191509.2| Integral membrane HRF1 family protein [Arabidop... 62 8e-08 >gb|EYU23874.1| hypothetical protein MIMGU_mgv1a011852mg [Mimulus guttatus] Length = 268 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 61 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 91 >gb|EXB88918.1| hypothetical protein L484_003614 [Morus notabilis] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_006352709.1| PREDICTED: protein YIF1B-like isoform X1 [Solanum tuberosum] gi|565372253|ref|XP_006352710.1| PREDICTED: protein YIF1B-like isoform X2 [Solanum tuberosum] gi|565372255|ref|XP_006352711.1| PREDICTED: protein YIF1B-like isoform X3 [Solanum tuberosum] gi|565372257|ref|XP_006352712.1| PREDICTED: protein YIF1B-like isoform X4 [Solanum tuberosum] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_006443001.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] gi|567901028|ref|XP_006443002.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] gi|567901030|ref|XP_006443003.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] gi|568850003|ref|XP_006478722.1| PREDICTED: protein YIF1B-like isoform X1 [Citrus sinensis] gi|568850005|ref|XP_006478723.1| PREDICTED: protein YIF1B-like isoform X2 [Citrus sinensis] gi|557545263|gb|ESR56241.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] gi|557545264|gb|ESR56242.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] gi|557545265|gb|ESR56243.1| hypothetical protein CICLE_v10021639mg [Citrus clementina] Length = 271 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 64 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 94 >ref|XP_006415396.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] gi|557093167|gb|ESQ33749.1| hypothetical protein EUTSA_v10008472mg [Eutrema salsugineum] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_006372856.1| hypothetical protein POPTR_0017s05720g [Populus trichocarpa] gi|550319504|gb|ERP50653.1| hypothetical protein POPTR_0017s05720g [Populus trichocarpa] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_007033919.1| Integral membrane HRF1 family protein [Theobroma cacao] gi|508712948|gb|EOY04845.1| Integral membrane HRF1 family protein [Theobroma cacao] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVA-LPFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV LPFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLLPFLHRGH 92 >ref|XP_006305529.1| hypothetical protein CARUB_v10010016mg [Capsella rubella] gi|482574240|gb|EOA38427.1| hypothetical protein CARUB_v10010016mg [Capsella rubella] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVA-LPFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV LPFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLLPFLHRGH 92 >ref|XP_004309807.1| PREDICTED: protein YIF1B-B-like [Fragaria vesca subsp. vesca] Length = 263 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 56 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 86 >ref|XP_007215807.1| hypothetical protein PRUPE_ppa009973mg [Prunus persica] gi|462411957|gb|EMJ17006.1| hypothetical protein PRUPE_ppa009973mg [Prunus persica] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_004242384.1| PREDICTED: protein YIF1B-like isoform 1 [Solanum lycopersicum] gi|460393576|ref|XP_004242385.1| PREDICTED: protein YIF1B-like isoform 2 [Solanum lycopersicum] gi|460393578|ref|XP_004242386.1| PREDICTED: protein YIF1B-like isoform 3 [Solanum lycopersicum] gi|460393580|ref|XP_004242387.1| PREDICTED: protein YIF1B-like isoform 4 [Solanum lycopersicum] gi|460393582|ref|XP_004242388.1| PREDICTED: protein YIF1B-like isoform 5 [Solanum lycopersicum] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_004152088.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] gi|449502274|ref|XP_004161595.1| PREDICTED: protein YIF1B-A-like [Cucumis sativus] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_002890912.1| integral membrane HRF1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297336754|gb|EFH67171.1| integral membrane HRF1 family protein [Arabidopsis lyrata subsp. lyrata] Length = 265 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 58 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 88 >ref|XP_002534138.1| Protein YIF1A, putative [Ricinus communis] gi|223525796|gb|EEF28242.1| Protein YIF1A, putative [Ricinus communis] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|NP_564367.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|145324088|ref|NP_001077633.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|14532658|gb|AAK64057.1| unknown protein [Arabidopsis thaliana] gi|21280943|gb|AAM44952.1| unknown protein [Arabidopsis thaliana] gi|21554340|gb|AAM63447.1| unknown [Arabidopsis thaliana] gi|332193168|gb|AEE31289.1| integral membrane HRF1-like protein [Arabidopsis thaliana] gi|332193169|gb|AEE31290.1| integral membrane HRF1-like protein [Arabidopsis thaliana] Length = 269 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKVVLFPFLHRGH 92 >ref|XP_006350294.1| PREDICTED: protein YIF1B-like [Solanum tuberosum] Length = 267 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 60 FSDPQYYFQVNDQYVRNKLKVILFPFLHRGH 90 >ref|XP_006402683.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] gi|557103782|gb|ESQ44136.1| hypothetical protein EUTSA_v10006169mg [Eutrema salsugineum] Length = 269 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLK+ L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKIVLFPFLHRGH 92 >ref|XP_006291680.1| hypothetical protein CARUB_v10017840mg [Capsella rubella] gi|482560387|gb|EOA24578.1| hypothetical protein CARUB_v10017840mg [Capsella rubella] Length = 269 Score = 62.0 bits (149), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLK+ L PFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKIVLFPFLHRGH 92 >ref|XP_004247110.1| PREDICTED: protein YIF1B-B-like [Solanum lycopersicum] Length = 267 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLKVAL-PFLHRGH 2 FSDPQYYFQVNDQYVRNKLKV L PFLHRGH Sbjct: 60 FSDPQYYFQVNDQYVRNKLKVILFPFLHRGH 90 >ref|NP_191509.2| Integral membrane HRF1 family protein [Arabidopsis thaliana] gi|332646412|gb|AEE79933.1| Integral membrane HRF1 family protein [Arabidopsis thaliana] gi|385137882|gb|AFI41202.1| HRF1 protein, partial [Arabidopsis thaliana] Length = 269 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/31 (93%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = -1 Query: 91 FSDPQYYFQVNDQYVRNKLK-VALPFLHRGH 2 FSDPQYYFQVNDQYVRNKLK V LPFLHRGH Sbjct: 62 FSDPQYYFQVNDQYVRNKLKIVLLPFLHRGH 92