BLASTX nr result
ID: Cocculus23_contig00002976
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00002976 (305 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF47291.2| ATP sulfurylase [Camellia sinensis] gi|452114162|... 59 7e-07 ref|XP_004134113.1| PREDICTED: ATP sulfurylase 1, chloroplastic-... 57 3e-06 >gb|ABF47291.2| ATP sulfurylase [Camellia sinensis] gi|452114162|gb|AGG09239.1| ATP sulfurylase APS2 [Camellia sinensis] Length = 465 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/65 (49%), Positives = 40/65 (61%) Frame = -1 Query: 197 MASMAALFVKTPNPAHSLAITQKTHLGFNAKFGISVQTQKRNQRIGDQKVRISCGLIEPD 18 MASMA LF K+PNP+ S T KTH + K +S + + R K+RISCGLI+PD Sbjct: 1 MASMALLFNKSPNPSLSFPKTHKTHYSTHLKLPLSHHSSPKTHR----KIRISCGLIDPD 56 Query: 17 GRNLV 3 G LV Sbjct: 57 GGKLV 61 >ref|XP_004134113.1| PREDICTED: ATP sulfurylase 1, chloroplastic-like [Cucumis sativus] gi|449514837|ref|XP_004164494.1| PREDICTED: ATP sulfurylase 1, chloroplastic-like [Cucumis sativus] Length = 467 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/65 (47%), Positives = 37/65 (56%) Frame = -1 Query: 197 MASMAALFVKTPNPAHSLAITQKTHLGFNAKFGISVQTQKRNQRIGDQKVRISCGLIEPD 18 MASMA F TP+P HS+ T THLG K IS K+ ++R+S GLIEPD Sbjct: 1 MASMATRFTNTPSPFHSIQRTSYTHLGAPVKVSISTSKSKKTH----LRLRVSAGLIEPD 56 Query: 17 GRNLV 3 G LV Sbjct: 57 GGKLV 61