BLASTX nr result
ID: Cocculus23_contig00002562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00002562 (242 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383369.1| hypothetical protein POPTR_0005s14930g [Popu... 63 5e-08 ref|XP_006383371.1| hypothetical protein POPTR_0005s14950g [Popu... 62 8e-08 ref|XP_006372496.1| hypothetical protein POPTR_0017s02200g [Popu... 60 3e-07 ref|XP_006372497.1| hypothetical protein POPTR_0017s02200g [Popu... 60 3e-07 ref|XP_006388707.1| hypothetical protein POPTR_0115s002502g, par... 60 4e-07 ref|XP_002307448.2| hypothetical protein POPTR_0005s14910g [Popu... 59 7e-07 ref|XP_006372510.1| hypothetical protein POPTR_0017s02320g [Popu... 59 9e-07 ref|XP_007033145.1| Cc-nbs-lrr resistance protein, putative isof... 59 9e-07 ref|XP_007033144.1| Cc-nbs-lrr resistance protein, putative isof... 59 9e-07 ref|XP_006388567.1| hypothetical protein POPTR_0154s00220g [Popu... 58 1e-06 gb|EXC01152.1| Putative disease resistance protein RGA3 [Morus n... 57 3e-06 ref|XP_007033757.1| Leucine-rich repeat containing-like protein ... 57 3e-06 >ref|XP_006383369.1| hypothetical protein POPTR_0005s14930g [Populus trichocarpa] gi|550338979|gb|ERP61166.1| hypothetical protein POPTR_0005s14930g [Populus trichocarpa] Length = 1128 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/74 (45%), Positives = 45/74 (60%) Frame = -3 Query: 231 IFPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMET 52 IF CL+ L IR CP L LP + ++++L I + LLRSV N TS+T L I F+E+ Sbjct: 848 IFTCLDELQIRKCPKLVELPIIPSVKHLTIEDCTVTLLRSVVNFTSITYLRIEGFDELAV 907 Query: 51 LPDKLATSHLSLLK 10 LPD L +H L K Sbjct: 908 LPDGLLQNHTCLQK 921 >ref|XP_006383371.1| hypothetical protein POPTR_0005s14950g [Populus trichocarpa] gi|550338981|gb|ERP61168.1| hypothetical protein POPTR_0005s14950g [Populus trichocarpa] Length = 1110 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/72 (47%), Positives = 44/72 (61%) Frame = -3 Query: 231 IFPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMET 52 IF CL+ L IR CP L LP + +++ L I + LLRSV N TS+TSL I F+E+ Sbjct: 853 IFTCLDELQIRKCPKLVELPIIPSVKYLTIEDCAVTLLRSVVNFTSITSLRIEGFDELAV 912 Query: 51 LPDKLATSHLSL 16 LPD L +H L Sbjct: 913 LPDGLLQNHTCL 924 >ref|XP_006372496.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] gi|550319122|gb|ERP50293.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] Length = 1131 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/76 (42%), Positives = 47/76 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FPCL L I CP L +P + +++ L I G N L SV N+TS+TSLY G+ ++ L Sbjct: 855 FPCLRELKIAYCPVLNEIPIIPSVKTLHIEGVNASWLVSVRNITSITSLYTGQIPKVREL 914 Query: 48 PDKLATSHLSLLKNLK 1 PD +H +LL++L+ Sbjct: 915 PDGFLQNH-TLLESLE 929 >ref|XP_006372497.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] gi|550319123|gb|ERP50294.1| hypothetical protein POPTR_0017s02200g [Populus trichocarpa] Length = 944 Score = 60.1 bits (144), Expect = 3e-07 Identities = 32/76 (42%), Positives = 47/76 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FPCL L I CP L +P + +++ L I G N L SV N+TS+TSLY G+ ++ L Sbjct: 791 FPCLRELKIAYCPVLNEIPIIPSVKTLHIEGVNASWLVSVRNITSITSLYTGQIPKVREL 850 Query: 48 PDKLATSHLSLLKNLK 1 PD +H +LL++L+ Sbjct: 851 PDGFLQNH-TLLESLE 865 >ref|XP_006388707.1| hypothetical protein POPTR_0115s002502g, partial [Populus trichocarpa] gi|550310689|gb|ERP47621.1| hypothetical protein POPTR_0115s002502g, partial [Populus trichocarpa] Length = 697 Score = 59.7 bits (143), Expect = 4e-07 Identities = 33/75 (44%), Positives = 46/75 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L I NCP L +P + +++ L+I G N L SV NLTS+TSL+IG + L Sbjct: 469 FPRLRELEIANCPVLNEIPIIPSVKTLSIHGVNASSLMSVRNLTSITSLHIGNIPNVREL 528 Query: 48 PDKLATSHLSLLKNL 4 PD +H +LL++L Sbjct: 529 PDGFLQNH-TLLESL 542 >ref|XP_002307448.2| hypothetical protein POPTR_0005s14910g [Populus trichocarpa] gi|550338977|gb|EEE94444.2| hypothetical protein POPTR_0005s14910g [Populus trichocarpa] Length = 1074 Score = 58.9 bits (141), Expect = 7e-07 Identities = 32/72 (44%), Positives = 44/72 (61%) Frame = -3 Query: 231 IFPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMET 52 IF CL L I CP L LP + ++++L I ++ LLRSV N +S+TSL I F+E+ Sbjct: 853 IFRCLHELQIGKCPKLVELPIIPSVKDLTIGDCSVTLLRSVVNFSSMTSLQIEGFDELTV 912 Query: 51 LPDKLATSHLSL 16 LPD L +H L Sbjct: 913 LPDGLLQNHTCL 924 >ref|XP_006372510.1| hypothetical protein POPTR_0017s02320g [Populus trichocarpa] gi|550319136|gb|ERP50307.1| hypothetical protein POPTR_0017s02320g [Populus trichocarpa] Length = 497 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/76 (42%), Positives = 48/76 (63%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L+I +CP L +P + +++ L I G N+ LL SV NL S+TSL+I + L Sbjct: 269 FPRLRELNIVDCPVLNEIPTIPSIKKLDIQGGNVSLLMSVRNLVSITSLHISWIPNVREL 328 Query: 48 PDKLATSHLSLLKNLK 1 PD L +H +LL++L+ Sbjct: 329 PDGLLQNH-TLLEDLR 343 >ref|XP_007033145.1| Cc-nbs-lrr resistance protein, putative isoform 2 [Theobroma cacao] gi|508712174|gb|EOY04071.1| Cc-nbs-lrr resistance protein, putative isoform 2 [Theobroma cacao] Length = 936 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/71 (46%), Positives = 44/71 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L IR+CP L LP LQ+L+ L I ++ LLRSV + T LTSL +G F+ + L Sbjct: 846 FPQLRSLVIRDCPKLVELPMLQSLKRLEIRETSVSLLRSVMHFTFLTSLLLGGFDGLTVL 905 Query: 48 PDKLATSHLSL 16 PD L ++ L Sbjct: 906 PDGLLQNYKHL 916 >ref|XP_007033144.1| Cc-nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] gi|508712173|gb|EOY04070.1| Cc-nbs-lrr resistance protein, putative isoform 1 [Theobroma cacao] Length = 1152 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/71 (46%), Positives = 44/71 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L IR+CP L LP LQ+L+ L I ++ LLRSV + T LTSL +G F+ + L Sbjct: 846 FPQLRSLVIRDCPKLVELPMLQSLKRLEIRETSVSLLRSVMHFTFLTSLLLGGFDGLTVL 905 Query: 48 PDKLATSHLSL 16 PD L ++ L Sbjct: 906 PDGLLQNYKHL 916 >ref|XP_006388567.1| hypothetical protein POPTR_0154s00220g [Populus trichocarpa] gi|550310410|gb|ERP47481.1| hypothetical protein POPTR_0154s00220g [Populus trichocarpa] Length = 1073 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/76 (42%), Positives = 45/76 (59%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L I CP L +P + +++ + I G N LL SV N TS+TSL+IG + L Sbjct: 845 FPRLRELKIDGCPLLNEMPIIPSVKTVQIFGVNTSLLMSVRNFTSITSLHIGNIPNVREL 904 Query: 48 PDKLATSHLSLLKNLK 1 PD +H SLL++L+ Sbjct: 905 PDGFLQNH-SLLESLE 919 >gb|EXC01152.1| Putative disease resistance protein RGA3 [Morus notabilis] Length = 1159 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/76 (40%), Positives = 47/76 (61%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FP L L++ CP L+ +P +L++L + G N ++LRS NLTSLTSL + +F E Sbjct: 853 FPSLHKLTVNKCPRLKNMPSFPSLKHLELRGCNDIVLRSASNLTSLTSLIVEEFPEQLIY 912 Query: 48 PDKLATSHLSLLKNLK 1 D L +++ LL +LK Sbjct: 913 LDLLLQNNI-LLMSLK 927 >ref|XP_007033757.1| Leucine-rich repeat containing-like protein isoform 1 [Theobroma cacao] gi|590654637|ref|XP_007033758.1| Leucine-rich repeat containing-like protein isoform 1 [Theobroma cacao] gi|508712786|gb|EOY04683.1| Leucine-rich repeat containing-like protein isoform 1 [Theobroma cacao] gi|508712787|gb|EOY04684.1| Leucine-rich repeat containing-like protein isoform 1 [Theobroma cacao] Length = 1028 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = -3 Query: 228 FPCLEVLSIRNCPSLRGLPQLQTLQNLAIVGDNMMLLRSVENLTSLTSLYIGKFEEMETL 49 FPCL+ L ++ C L LP + L++LA+ N MLL SV +L SL+SL I K +E+E+L Sbjct: 847 FPCLDKLVVKGCRRLTALPVIPNLRSLALCDSNGMLLCSVVHLPSLSSLVIEKLKELESL 906 Query: 48 PD 43 D Sbjct: 907 TD 908