BLASTX nr result
ID: Cocculus23_contig00002428
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00002428 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004303591.1| PREDICTED: 60S ribosomal protein L3-like [Fr... 147 1e-33 ref|XP_004290498.1| PREDICTED: 60S ribosomal protein L3-like [Fr... 147 1e-33 ref|XP_007199920.1| hypothetical protein PRUPE_ppa006941mg [Prun... 147 1e-33 gb|EXC12323.1| 60S ribosomal protein L3 [Morus notabilis] 147 1e-33 ref|NP_001233997.1| ribosomal protein L3 [Solanum lycopersicum] ... 147 1e-33 ref|XP_002263053.2| PREDICTED: 60S ribosomal protein L3 [Vitis v... 146 3e-33 emb|CAN83050.1| hypothetical protein VITISV_042376 [Vitis vinifera] 146 3e-33 gb|EYU33272.1| hypothetical protein MIMGU_mgv1a007974mg [Mimulus... 145 4e-33 gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] 145 4e-33 ref|XP_006838909.1| hypothetical protein AMTR_s00002p00269670 [A... 145 4e-33 ref|XP_006828498.1| hypothetical protein AMTR_s00060p00174830 [A... 145 4e-33 ref|XP_007223051.1| hypothetical protein PRUPE_ppa006946mg [Prun... 145 4e-33 ref|NP_001275276.1| 60S ribosomal protein L3-like [Solanum tuber... 145 4e-33 ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus ... 145 6e-33 ref|NP_175009.1| 60S ribosomal protein L3-1 [Arabidopsis thalian... 144 1e-32 ref|XP_006434488.1| hypothetical protein CICLE_v10001454mg [Citr... 144 1e-32 ref|NP_001077671.1| 60S ribosomal protein L3-1 [Arabidopsis thal... 144 1e-32 dbj|BAF02060.1| hypothetical protein [Arabidopsis thaliana] 144 1e-32 gb|AAQ96335.1| ribosomal protein L3A [Nicotiana tabacum] 144 1e-32 gb|AAN31896.1| putative ribosomal protein [Arabidopsis thaliana] 144 1e-32 >ref|XP_004303591.1| PREDICTED: 60S ribosomal protein L3-like [Fragaria vesca subsp. vesca] Length = 389 Score = 147 bits (372), Expect = 1e-33 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TEFDRTEKDITPIGGFPHYG+VK+DY+LI Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKAGQESHTAVTEFDRTEKDITPIGGFPHYGVVKDDYILI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_004290498.1| PREDICTED: 60S ribosomal protein L3-like [Fragaria vesca subsp. vesca] Length = 389 Score = 147 bits (372), Expect = 1e-33 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TEFDRTEKDITPIGGFPHYG+VK+DY+LI Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKAGQESHTAVTEFDRTEKDITPIGGFPHYGVVKDDYILI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_007199920.1| hypothetical protein PRUPE_ppa006941mg [Prunus persica] gi|462395320|gb|EMJ01119.1| hypothetical protein PRUPE_ppa006941mg [Prunus persica] Length = 389 Score = 147 bits (372), Expect = 1e-33 Identities = 65/73 (89%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TEFDRTEKDITPIGGFPHYG+VK+DY+LI Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKAGQESHTAVTEFDRTEKDITPIGGFPHYGVVKDDYILI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >gb|EXC12323.1| 60S ribosomal protein L3 [Morus notabilis] Length = 410 Score = 147 bits (371), Expect = 1e-33 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKKVYKLGK G ES+TA+TEFDRTEKDITPIGGFPHYG+VK+D+LLI Sbjct: 290 RAGQNGYHHRTEMNKKVYKLGKAGQESHTAITEFDRTEKDITPIGGFPHYGVVKDDFLLI 349 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 350 KGCCVGPKKRVVT 362 >ref|NP_001233997.1| ribosomal protein L3 [Solanum lycopersicum] gi|38327504|gb|AAR17783.1| ribosomal protein L3 [Solanum lycopersicum] Length = 389 Score = 147 bits (371), Expect = 1e-33 Identities = 67/73 (91%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKKVYKLGKVG ES+TA+TEFDRTEKDITPIGGFPHYG+VK DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKVYKLGKVGQESHTALTEFDRTEKDITPIGGFPHYGVVKEDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVG KKRVVT Sbjct: 329 KGCCVGTKKRVVT 341 >ref|XP_002263053.2| PREDICTED: 60S ribosomal protein L3 [Vitis vinifera] gi|297739519|emb|CBI29701.3| unnamed protein product [Vitis vinifera] Length = 389 Score = 146 bits (368), Expect = 3e-33 Identities = 64/73 (87%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YK+GK G ES++AMTEFDRTEKDITP+GGFPHYG+VK+DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKIYKVGKTGQESHSAMTEFDRTEKDITPMGGFPHYGVVKDDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >emb|CAN83050.1| hypothetical protein VITISV_042376 [Vitis vinifera] Length = 389 Score = 146 bits (368), Expect = 3e-33 Identities = 64/73 (87%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YK+GK G ES++AMTEFDRTEKDITP+GGFPHYG+VK+DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKIYKVGKTGQESHSAMTEFDRTEKDITPMGGFPHYGVVKDDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >gb|EYU33272.1| hypothetical protein MIMGU_mgv1a007974mg [Mimulus guttatus] Length = 389 Score = 145 bits (367), Expect = 4e-33 Identities = 64/73 (87%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G E++ AMTEFDRTEKDITP+GGFPHYG+VK+DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKTGQETHNAMTEFDRTEKDITPMGGFPHYGVVKDDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >gb|EXB30757.1| 60S ribosomal protein L3 [Morus notabilis] Length = 389 Score = 145 bits (367), Expect = 4e-33 Identities = 64/73 (87%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES++AMTEFDRTEKDITPIGGFPHYG+VK D+L+I Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKAGQESHSAMTEFDRTEKDITPIGGFPHYGVVKEDFLMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_006838909.1| hypothetical protein AMTR_s00002p00269670 [Amborella trichopoda] gi|548841415|gb|ERN01478.1| hypothetical protein AMTR_s00002p00269670 [Amborella trichopoda] Length = 363 Score = 145 bits (367), Expect = 4e-33 Identities = 63/73 (86%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TEFDRTEKDITP+GGFPHYG+VK+DY++I Sbjct: 243 RAGQNGYHHRTEMNKKIYKLGKAGQESHTAITEFDRTEKDITPMGGFPHYGVVKDDYIMI 302 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 303 KGCCVGPKKRVVT 315 >ref|XP_006828498.1| hypothetical protein AMTR_s00060p00174830 [Amborella trichopoda] gi|548833246|gb|ERM95914.1| hypothetical protein AMTR_s00060p00174830 [Amborella trichopoda] Length = 389 Score = 145 bits (367), Expect = 4e-33 Identities = 63/73 (86%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TEFDRTEKDITP+GGFPHYG+VK+DY++I Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKAGQESHTAITEFDRTEKDITPMGGFPHYGVVKDDYIMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_007223051.1| hypothetical protein PRUPE_ppa006946mg [Prunus persica] gi|462419987|gb|EMJ24250.1| hypothetical protein PRUPE_ppa006946mg [Prunus persica] Length = 389 Score = 145 bits (367), Expect = 4e-33 Identities = 65/73 (89%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGKVG ES++AMTEFDRTEKDITP+GGFPHYG VK DYLL+ Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKVGQESHSAMTEFDRTEKDITPMGGFPHYGAVKEDYLLM 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|NP_001275276.1| 60S ribosomal protein L3-like [Solanum tuberosum] gi|82623411|gb|ABB87120.1| ribosomal protein L3-like [Solanum tuberosum] Length = 389 Score = 145 bits (367), Expect = 4e-33 Identities = 66/73 (90%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKKVYKLGKVG ES+TA+TEFDRTEK+ITPIGGF HYG+VK+DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKVYKLGKVGQESHTAVTEFDRTEKEITPIGGFAHYGVVKDDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_002524302.1| 60S ribosomal protein L3, putative [Ricinus communis] gi|223536393|gb|EEF38042.1| 60S ribosomal protein L3, putative [Ricinus communis] Length = 389 Score = 145 bits (366), Expect = 6e-33 Identities = 64/73 (87%), Positives = 71/73 (97%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKK+YKLGK G ES+TA+TE+DRTEKDITPIGGFPHYG+VK+DYL+I Sbjct: 269 RAGQNGYHHRTEMNKKIYKLGKGGQESHTAITEYDRTEKDITPIGGFPHYGVVKDDYLMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|NP_175009.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|42571751|ref|NP_973966.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|79319275|ref|NP_001031146.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|334183068|ref|NP_001185148.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|334183070|ref|NP_001185149.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|334183072|ref|NP_001185150.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|334183074|ref|NP_001185151.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|334183076|ref|NP_001185152.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|27735225|sp|P17094.5|RL31_ARATH RecName: Full=60S ribosomal protein L3-1; AltName: Full=Protein EMBRYO DEFECTIVE 2207 gi|11935191|gb|AAG42011.1|AF327421_1 putative ribosomal protein [Arabidopsis thaliana] gi|13487800|gb|AAK27726.1|AF361101_1 putative ribosomal protein [Arabidopsis thaliana] gi|13605657|gb|AAK32822.1|AF361809_1 At1g43170/F1I21_18 [Arabidopsis thaliana] gi|3617741|gb|AAC36018.1| L3 cytoplasmic ribosomal protein [Arabidopsis thaliana] gi|14517418|gb|AAK62599.1| At1g43170/F1I21_18 [Arabidopsis thaliana] gi|15450559|gb|AAK96457.1| At1g43170/F1I21_18 [Arabidopsis thaliana] gi|15982761|gb|AAL09721.1| At1g43170/F1I21_18 [Arabidopsis thaliana] gi|332193830|gb|AEE31951.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193831|gb|AEE31952.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193832|gb|AEE31953.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193834|gb|AEE31955.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193835|gb|AEE31956.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193836|gb|AEE31957.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193837|gb|AEE31958.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193838|gb|AEE31959.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] Length = 389 Score = 144 bits (364), Expect = 1e-32 Identities = 62/73 (84%), Positives = 72/73 (98%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTE+NKK+Y+LGKVG E++TAMTE+DRTEKD+TP+GGFPHYGIVK+DYL+I Sbjct: 269 RAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|XP_006434488.1| hypothetical protein CICLE_v10001454mg [Citrus clementina] gi|568838147|ref|XP_006473077.1| PREDICTED: 60S ribosomal protein L3-like [Citrus sinensis] gi|557536610|gb|ESR47728.1| hypothetical protein CICLE_v10001454mg [Citrus clementina] Length = 389 Score = 144 bits (364), Expect = 1e-32 Identities = 65/73 (89%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKKVYKLGK G ES+T +TEFDRTEKDITP+GGFPHYGIVK+DYL+I Sbjct: 269 RAGQNGYHHRTEMNKKVYKLGKGGQESHTGITEFDRTEKDITPMGGFPHYGIVKDDYLMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >ref|NP_001077671.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] gi|332193833|gb|AEE31954.1| 60S ribosomal protein L3-1 [Arabidopsis thaliana] Length = 306 Score = 144 bits (364), Expect = 1e-32 Identities = 62/73 (84%), Positives = 72/73 (98%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTE+NKK+Y+LGKVG E++TAMTE+DRTEKD+TP+GGFPHYGIVK+DYL+I Sbjct: 186 RAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMI 245 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 246 KGCCVGPKKRVVT 258 >dbj|BAF02060.1| hypothetical protein [Arabidopsis thaliana] Length = 555 Score = 144 bits (364), Expect = 1e-32 Identities = 62/73 (84%), Positives = 72/73 (98%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTE+NKK+Y+LGKVG E++TAMTE+DRTEKD+TP+GGFPHYGIVK+DYL+I Sbjct: 435 RAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMI 494 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 495 KGCCVGPKKRVVT 507 >gb|AAQ96335.1| ribosomal protein L3A [Nicotiana tabacum] Length = 389 Score = 144 bits (364), Expect = 1e-32 Identities = 64/73 (87%), Positives = 70/73 (95%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTEMNKKVYKLGK G ES+ A+T+FDRTEKDITP+GGFPHYG+VK+DYLLI Sbjct: 269 RAGQNGYHHRTEMNKKVYKLGKAGQESHAAVTDFDRTEKDITPMGGFPHYGVVKDDYLLI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341 >gb|AAN31896.1| putative ribosomal protein [Arabidopsis thaliana] Length = 389 Score = 144 bits (364), Expect = 1e-32 Identities = 62/73 (84%), Positives = 72/73 (98%) Frame = -3 Query: 220 RAGQNGYHHRTEMNKKVYKLGKVGDESYTAMTEFDRTEKDITPIGGFPHYGIVKNDYLLI 41 RAGQNGYHHRTE+NKK+Y+LGKVG E++TAMTE+DRTEKD+TP+GGFPHYGIVK+DYL+I Sbjct: 269 RAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTEYDRTEKDVTPMGGFPHYGIVKDDYLMI 328 Query: 40 KGCCVGPKKRVVT 2 KGCCVGPKKRVVT Sbjct: 329 KGCCVGPKKRVVT 341