BLASTX nr result
ID: Cocculus23_contig00000322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00000322 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283180.1| PREDICTED: uncharacterized protein LOC100245... 67 2e-09 ref|XP_007206135.1| hypothetical protein PRUPE_ppa013236mg [Prun... 64 2e-08 gb|AAB88876.1| putative auxin-repressed protein [Prunus armeniaca] 64 2e-08 ref|XP_002512449.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 gb|AGV54698.1| hypothetical protein [Phaseolus vulgaris] 64 3e-08 ref|XP_004494581.1| PREDICTED: uncharacterized protein LOC101493... 64 3e-08 ref|XP_007031020.1| Dormancy/auxin associated family protein iso... 62 6e-08 ref|XP_007031019.1| Drm3-like protein isoform 1 [Theobroma cacao... 62 6e-08 ref|XP_007144957.1| hypothetical protein PHAVU_007G197700g [Phas... 62 8e-08 ref|XP_003591159.1| Auxin-repressed 12.5 kDa protein [Medicago t... 62 8e-08 gb|AGG19166.1| auxin-repressed protein [Pyrus pyrifolia] 62 1e-07 ref|XP_003521684.1| PREDICTED: uncharacterized protein LOC100805... 62 1e-07 ref|XP_007147009.1| hypothetical protein PHAVU_006G089000g [Phas... 61 1e-07 ref|XP_006375740.1| hypothetical protein POPTR_0013s01640g [Popu... 61 2e-07 ref|XP_004495694.1| PREDICTED: uncharacterized protein LOC101493... 61 2e-07 ref|XP_007206134.1| hypothetical protein PRUPE_ppa013236mg [Prun... 60 2e-07 ref|XP_006604804.1| PREDICTED: uncharacterized protein LOC100814... 60 3e-07 ref|XP_006433432.1| hypothetical protein CICLE_v10002843mg [Citr... 60 4e-07 gb|ABK96622.1| unknown [Populus trichocarpa x Populus deltoides]... 59 5e-07 ref|XP_006396488.1| hypothetical protein EUTSA_v10029065mg [Eutr... 57 3e-06 >ref|XP_002283180.1| PREDICTED: uncharacterized protein LOC100245909 isoform 1 [Vitis vinifera] gi|296089731|emb|CBI39550.3| unnamed protein product [Vitis vinifera] Length = 126 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGSTPPVSPFSGG+ +S RFRRRSTSD YE+ GNG G RS P+DV Sbjct: 78 PVSPAGSTPPVSPFSGGK--ESFRFRRRSTSDAYEK-GNGVGP---RSPRPPYDV 126 >ref|XP_007206135.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica] gi|462401777|gb|EMJ07334.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica] Length = 133 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSGG S RFRRRS SD YE+ G S +PFDV Sbjct: 81 PISPAGSTPPVSPFSGGSS--MGRFRRRSASDAYEKASQVGGGGARSSPRSPFDV 133 >gb|AAB88876.1| putative auxin-repressed protein [Prunus armeniaca] Length = 133 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSGG S RFRRRS SD YE+ G S +PFDV Sbjct: 81 PISPAGSTPPVSPFSGGSS--MGRFRRRSASDAYEKASQVGGGGARSSPRSPFDV 133 >ref|XP_002512449.1| conserved hypothetical protein [Ricinus communis] gi|223548410|gb|EEF49901.1| conserved hypothetical protein [Ricinus communis] Length = 125 Score = 63.9 bits (154), Expect = 2e-08 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGSTPPVSPFSGGR +S RFRRRSTSD YE+ RS + P+DV Sbjct: 77 PVSPAGSTPPVSPFSGGR--ESFRFRRRSTSDAYEKASEVG----PRSPAPPYDV 125 >gb|AGV54698.1| hypothetical protein [Phaseolus vulgaris] Length = 127 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/55 (61%), Positives = 39/55 (70%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P SPAGSTPPVSPFSG + +S RFRRRSTSD +E+TG S S+PFDV Sbjct: 79 PASPAGSTPPVSPFSGA-TRESFRFRRRSTSDAFEKTGQNRPSS-----SSPFDV 127 >ref|XP_004494581.1| PREDICTED: uncharacterized protein LOC101493722 isoform X2 [Cicer arietinum] Length = 124 Score = 63.5 bits (153), Expect = 3e-08 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFD 142 PISPAGSTPPVSPFSG R +S RFRRRSTSD YE+ G + S+PFD Sbjct: 77 PISPAGSTPPVSPFSGTR--ESFRFRRRSTSDAYEKRGQNRSNP-----SSPFD 123 >ref|XP_007031020.1| Dormancy/auxin associated family protein isoform 2 [Theobroma cacao] gi|508719625|gb|EOY11522.1| Dormancy/auxin associated family protein isoform 2 [Theobroma cacao] Length = 124 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSGGR +S RFRR+STSD YE+ RS P+DV Sbjct: 76 PISPAGSTPPVSPFSGGR--ESFRFRRKSTSDAYEKASEVG----PRSPHPPYDV 124 >ref|XP_007031019.1| Drm3-like protein isoform 1 [Theobroma cacao] gi|508719624|gb|EOY11521.1| Drm3-like protein isoform 1 [Theobroma cacao] Length = 125 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/55 (61%), Positives = 38/55 (69%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSGGR +S RFRR+STSD YE+ RS P+DV Sbjct: 77 PISPAGSTPPVSPFSGGR--ESFRFRRKSTSDAYEKASEVG----PRSPHPPYDV 125 >ref|XP_007144957.1| hypothetical protein PHAVU_007G197700g [Phaseolus vulgaris] gi|561018147|gb|ESW16951.1| hypothetical protein PHAVU_007G197700g [Phaseolus vulgaris] Length = 127 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/55 (63%), Positives = 41/55 (74%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P SPAGSTPPVSPFSG + +S RFRRRSTSD +E+ NG +R S S+PFDV Sbjct: 79 PASPAGSTPPVSPFSGA-TRESFRFRRRSTSDAFEK----NGQNRPNS-SSPFDV 127 >ref|XP_003591159.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|355480207|gb|AES61410.1| Auxin-repressed 12.5 kDa protein [Medicago truncatula] gi|388494480|gb|AFK35306.1| unknown [Medicago truncatula] Length = 128 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/55 (61%), Positives = 37/55 (67%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P SPAGSTPPVSPFSG R + RFRRRSTSD YE+ G S S+PFDV Sbjct: 79 PASPAGSTPPVSPFSGAR--EPFRFRRRSTSDAYEKEKTGTNRP---SPSSPFDV 128 >gb|AGG19166.1| auxin-repressed protein [Pyrus pyrifolia] Length = 139 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSGGR + RFRR+S SD YE+ G RS +P+DV Sbjct: 89 PISPAGSTPPVSPFSGGR-EPFGRFRRKSASDAYEKASQVVGG---RSARSPYDV 139 >ref|XP_003521684.1| PREDICTED: uncharacterized protein LOC100805572 isoformX1 [Glycine max] Length = 124 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGSTPP+SPFSGG+ S RFRRRS SD YE+ G S+PFDV Sbjct: 77 PVSPAGSTPPISPFSGGK--DSLRFRRRSGSDAYEKRGQNRSGP-----SSPFDV 124 >ref|XP_007147009.1| hypothetical protein PHAVU_006G089000g [Phaseolus vulgaris] gi|561020232|gb|ESW19003.1| hypothetical protein PHAVU_006G089000g [Phaseolus vulgaris] Length = 156 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/55 (56%), Positives = 37/55 (67%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGSTPPVSPF+GG+ S RFRRRS SD YE+ G S+P+DV Sbjct: 109 PVSPAGSTPPVSPFAGGK--DSSRFRRRSASDAYEKRGQNRSGP-----SSPYDV 156 >ref|XP_006375740.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa] gi|550324702|gb|ERP53537.1| hypothetical protein POPTR_0013s01640g [Populus trichocarpa] Length = 133 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNG 184 P SPAGSTPPVSPFSG R +S RFRRRSTSD YE+T G Sbjct: 85 PASPAGSTPPVSPFSGSR--ESFRFRRRSTSDAYEKTTEG 122 >ref|XP_004495694.1| PREDICTED: uncharacterized protein LOC101493302 [Cicer arietinum] Length = 129 Score = 60.8 bits (146), Expect = 2e-07 Identities = 34/55 (61%), Positives = 36/55 (65%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P SPAGSTPPVSPFSGGR + RF RRSTS YE N RS S+PFDV Sbjct: 80 PASPAGSTPPVSPFSGGR--EGFRFGRRSTSSAYE---NEKAGQNRRSPSSPFDV 129 >ref|XP_007206134.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica] gi|462401776|gb|EMJ07333.1| hypothetical protein PRUPE_ppa013236mg [Prunus persica] Length = 132 Score = 60.5 bits (145), Expect = 2e-07 Identities = 32/55 (58%), Positives = 34/55 (61%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 PISPAGSTPPVSPFSG RFRRRS SD YE+ G S +PFDV Sbjct: 81 PISPAGSTPPVSPFSG---SSMGRFRRRSASDAYEKASQVGGGGARSSPRSPFDV 132 >ref|XP_006604804.1| PREDICTED: uncharacterized protein LOC100814324 isoform X2 [Glycine max] Length = 207 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGST P+SPFSGG+ S RFRRRS SD YE+ G S+PFDV Sbjct: 160 PVSPAGSTTPISPFSGGK--DSFRFRRRSASDAYEKRGQNRSGP-----SSPFDV 207 >ref|XP_006433432.1| hypothetical protein CICLE_v10002843mg [Citrus clementina] gi|568836137|ref|XP_006472104.1| PREDICTED: uncharacterized protein LOC102616956 [Citrus sinensis] gi|557535554|gb|ESR46672.1| hypothetical protein CICLE_v10002843mg [Citrus clementina] Length = 127 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/55 (58%), Positives = 37/55 (67%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDRVRSVSAPFDV 139 P+SPAGSTPPVSPFS G D S RFRRRS SD YE+ +RS + P+DV Sbjct: 78 PVSPAGSTPPVSPFSAGGRD-SFRFRRRSASDAYEKRNEVG----LRSPTTPYDV 127 >gb|ABK96622.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489784|gb|ABK96692.1| unknown [Populus trichocarpa x Populus deltoides] Length = 133 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERT 193 P SPAGSTPPVSPFSG R +S RFRRRSTSD YE+T Sbjct: 85 PASPAGSTPPVSPFSGSR--ESFRFRRRSTSDAYEKT 119 >ref|XP_006396488.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum] gi|557097505|gb|ESQ37941.1| hypothetical protein EUTSA_v10029065mg [Eutrema salsugineum] Length = 128 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = -1 Query: 303 PISPAGSTPPVSPFSGGRSDQSHRFRRRSTSDVYERTGNGNGSDR 169 P+SPAGSTPPVSPFSGG+ + RFRRRSTSD +++ R Sbjct: 78 PVSPAGSTPPVSPFSGGK--EPFRFRRRSTSDAFDKAAGSESGPR 120