BLASTX nr result
ID: Cocculus23_contig00000235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus23_contig00000235 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523985.1| ATPP2-A2, putative [Ricinus communis] gi|223... 60 4e-07 >ref|XP_002523985.1| ATPP2-A2, putative [Ricinus communis] gi|223536712|gb|EEF38353.1| ATPP2-A2, putative [Ricinus communis] Length = 160 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -1 Query: 259 GTFLNHKVEKGELQFSLFEHGGHWKKGLVVGGAIIRPK 146 G FL K +KGE+ F +FEHGGHWK GL+V GAI+RPK Sbjct: 122 GNFLTKKGDKGEVCFDVFEHGGHWKNGLIVKGAILRPK 159