BLASTX nr result
ID: Cocculus22_contig00032351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00032351 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, part... 39 6e-06 >ref|XP_007224597.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] gi|462421533|gb|EMJ25796.1| hypothetical protein PRUPE_ppa027084mg, partial [Prunus persica] Length = 295 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 61 QWRTRCRIDDESINHLFPHCSFSSYLW 141 QW C++ +ES++HLF HC FS LW Sbjct: 165 QWCVLCKLCEESVDHLFLHCPFSLSLW 191 Score = 37.0 bits (84), Expect(2) = 6e-06 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 156 EVNWTWVTPR--REWIT*RRVPRLQDKRRQFMWNYMANSILWLIWLERNQRNFE 311 EV WV P+ +++ V K +W + +S+ W+IW+ERN+R FE Sbjct: 197 EVGTVWVIPKGCSDFLCSDFVVWGLGKLTSTLWGCLVHSVFWIIWMERNRRIFE 250