BLASTX nr result
ID: Cocculus22_contig00032344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00032344 (277 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003573536.1| PREDICTED: queuine tRNA-ribosyltransferase s... 57 2e-06 gb|EMT26220.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [A... 57 3e-06 gb|EMS57961.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [T... 57 3e-06 ref|XP_007019819.1| Uncharacterized protein isoform 1 [Theobroma... 56 6e-06 >ref|XP_003573536.1| PREDICTED: queuine tRNA-ribosyltransferase subunit QTRTD1-like [Brachypodium distachyon] Length = 396 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 168 AGGRNVLGAIVGGSSIEQRIRCAEEVTRRNVSGYWL 275 A G+N LG +VGGSSIE+R RCA EV++RNVSG+W+ Sbjct: 179 AAGQNTLGVVVGGSSIEERKRCATEVSKRNVSGFWI 214 >gb|EMT26220.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [Aegilops tauschii] Length = 396 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +3 Query: 144 PSLLFVI*AGGRNVLGAIVGGSSIEQRIRCAEEVTRRNVSGYWL 275 P F A GRN LG +VGGSSIEQR CA EV++RNVSG+W+ Sbjct: 137 PCEFFRAQASGRNSLGVVVGGSSIEQRKLCATEVSKRNVSGFWI 180 >gb|EMS57961.1| Queuine tRNA-ribosyltransferase subunit qtrtd1 [Triticum urartu] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 168 AGGRNVLGAIVGGSSIEQRIRCAEEVTRRNVSGYWL 275 A GRN LG +VGGSSIEQR CA EV++RNVSG+W+ Sbjct: 129 ASGRNSLGVVVGGSSIEQRKLCATEVSKRNVSGFWI 164 >ref|XP_007019819.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508725147|gb|EOY17044.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 405 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 174 GRNVLGAIVGGSSIEQRIRCAEEVTRRNVSGYWL 275 G V GAIVGGSS+E+R RCA+EV RRNVSGYW+ Sbjct: 180 GGAVFGAIVGGSSLEERQRCAQEVARRNVSGYWV 213