BLASTX nr result
ID: Cocculus22_contig00032076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00032076 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515319.1| conserved hypothetical protein [Ricinus comm... 69 5e-10 ref|XP_007051054.1| Uncharacterized protein TCM_004762 [Theobrom... 69 9e-10 ref|XP_003591457.1| hypothetical protein MTR_1g087740 [Medicago ... 56 4e-06 >ref|XP_002515319.1| conserved hypothetical protein [Ricinus communis] gi|223545799|gb|EEF47303.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 69.3 bits (168), Expect = 5e-10 Identities = 40/76 (52%), Positives = 48/76 (63%) Frame = +3 Query: 69 MASENANAEATGDTCIGSHEAVAIRRSTEIESTSQSHFDRAVAHRALYGSSHRRRIGSRK 248 MA+E ANAE + G+ E A S E T+ F +A+AHRALYGSS RR GSRK Sbjct: 1 MATEKANAEVSNTHTDGNQEKSAESSSNSKEFTAPPRFGKALAHRALYGSS-SRRAGSRK 59 Query: 249 ARENETRLSPSRLSKV 296 R+N+TR PSRLS V Sbjct: 60 VRDNDTRTLPSRLSNV 75 >ref|XP_007051054.1| Uncharacterized protein TCM_004762 [Theobroma cacao] gi|508703315|gb|EOX95211.1| Uncharacterized protein TCM_004762 [Theobroma cacao] Length = 85 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/76 (47%), Positives = 48/76 (63%) Frame = +3 Query: 69 MASENANAEATGDTCIGSHEAVAIRRSTEIESTSQSHFDRAVAHRALYGSSHRRRIGSRK 248 MA+E AN + T DT + + RS + +++ HF +A+AHRA+YGSS RR GSRK Sbjct: 1 MATEKANYDQTVDTQNYHTQENSTERSASSQGSAKFHFSKALAHRAVYGSSSRRSTGSRK 60 Query: 249 ARENETRLSPSRLSKV 296 R + R PSRLSKV Sbjct: 61 VRSTDARTLPSRLSKV 76 >ref|XP_003591457.1| hypothetical protein MTR_1g087740 [Medicago truncatula] gi|355480505|gb|AES61708.1| hypothetical protein MTR_1g087740 [Medicago truncatula] Length = 83 Score = 56.2 bits (134), Expect = 4e-06 Identities = 34/77 (44%), Positives = 50/77 (64%), Gaps = 1/77 (1%) Frame = +3 Query: 69 MASENANAEATGDTCIGSHEAVAIRRSTEIESTSQSHFDRAVAHRALYGSSHRRRIGSRK 248 M ++ NAE +G+ ++ + RS+ I+ HF +A+A RA+YGSS +R GSRK Sbjct: 1 MDTKIGNAEISGN-----NDDDYVERSSNIKHLENFHFGKALAFRAVYGSSGFQRSGSRK 55 Query: 249 ARENETR-LSPSRLSKV 296 R N+++ LSPSRLSKV Sbjct: 56 TRGNDSKTLSPSRLSKV 72