BLASTX nr result
ID: Cocculus22_contig00032047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00032047 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004301734.1| PREDICTED: uncharacterized protein LOC101299... 57 4e-06 ref|XP_007209412.1| hypothetical protein PRUPE_ppa009287mg [Prun... 56 6e-06 >ref|XP_004301734.1| PREDICTED: uncharacterized protein LOC101299012 [Fragaria vesca subsp. vesca] Length = 307 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 1 VLVEELKVPPSKLRASKTSSTKSISPCSNCFECRRRQK 114 +LVE+LKVPPSKL+AS TS + SPCS+CFECRR+Q+ Sbjct: 270 ILVEDLKVPPSKLQASYTSKIR--SPCSDCFECRRKQR 305 >ref|XP_007209412.1| hypothetical protein PRUPE_ppa009287mg [Prunus persica] gi|462405147|gb|EMJ10611.1| hypothetical protein PRUPE_ppa009287mg [Prunus persica] Length = 298 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/38 (65%), Positives = 35/38 (92%) Frame = +1 Query: 1 VLVEELKVPPSKLRASKTSSTKSISPCSNCFECRRRQK 114 VL+E+LK+PPSKL+AS SS+K+ SPC++CFECRR+Q+ Sbjct: 261 VLMEDLKIPPSKLQAS--SSSKNKSPCTDCFECRRKQR 296